tooth whitening strip and teeth whitening method using said strip

专利摘要:
PERACID GENERATING COMPOSITIONS. Described herein are tooth whitening strips, which comprise a hydratable adhesive film having a granular whitening ingredient attached thereto, in which upon hydration, the granular whitening ingredient releases hydrogen peroxide, which is used by a catalyst enzyme having perhydrolytic activity to enzymatically produce an effective amount of perishable bleach from an acyl donor substrate. Methods for preparing and using the teeth whitening strips are also provided.
公开号:BR112014014771B1
申请号:R112014014771-0
申请日:2012-12-18
公开日:2021-05-25
发明作者:Guofeng Xu；Steven Miller；Thomas J. Boyd；Richard Adams；Robert Pierce；David Viscio；Kari A. Fosser；Robert DiCosimo；Hong Wang
申请人:E.I. Du Pont De Nemours And Company；Colgate-Palmolive Company；
IPC主号:

专利说明:

CROSS REFERENCE TO RELATED ORDERS
[001] This application claims priority to US Provisional Application No. 61/577,499, filed December 19, 2011, which is hereby incorporated by reference in its entirety. BACKGROUND OF THE INVENTION
[002] There is a need for bleaching strips suitable for home use, with reduced total levels of peroxide, yet still providing increased bleaching activity. ABSTRACT
[003] The invention provides bleaching strips comprising a granular bleaching ingredient together with an enzyme with perhydrolytic activity ("perhydrolase"), which comprises the conserved structural portion of the carbohydrate esterase 7 and acyl donor family of so that, after use, the peroxide released by the granular whitening ingredient reacts with the acyl donor in the presence of the perhydrolase to form a peracid, in direct proximity to the teeth, without substantial dilution of the formulation excipients, thereby allowing increased whitening of teeth with much smaller amounts of peroxide.
[004] The strips comprise an adhesive film, single-layer or in multiple layers (for example, two layers) which, when hydrated with water or saliva, becomes sufficiently adhesive to adhere to teeth. The granular whitening ingredient is attached to the side of the film to be brought into contact with the teeth. After application, the whitening ingredient is placed directly on the teeth (ie, between the teeth and the adhesive layer). The granules then release peroxide by rapidly dissolving in water. The bleaching ingredient can optionally be coated with a rapidly dissolving material such as sodium sulphate, corn starch or gum arabic. Optionally, the strips provide a second layer on the film, which is present to extend exposure time. This second layer can be insoluble in water, which would require the user to remove the strip after treatment, or erodible in water, which would cause the strip to dissolve after sufficient treatment. The strip further comprises a perhydrolase (an enzyme capable of catalyzing the reaction of the carboxylic acid ester with hydrogen peroxide to form a peracid), which can also be supplied in granular form on the film surface, and an acyl donor. , for example, selected from carboxylic acids and acyl compounds, for example, triacetin or sorbitol hexaacetate, where the acyl donor reacts with the peroxide source in the strip in the presence of the perhydrolase to form a peracid, which increases the whitening action of the strip.
[005] Some embodiments of the present invention provide a tooth whitening strip comprising a hydratable adhesive film with a first side and a second side, the first side having a granular whitening ingredient attached thereto, the whitening strip tooth further comprises, in or on the film, or in the form of granules attached to the first side of the film; a) an enzyme with perhydrolytic activity, said enzyme having a signature portion of the carbohydrate esterase family 7 (CE-7) that aligns with a reference sequence SEQ ID NO: 1, said signature portion comprising: i) an RGQ motif portion at positions corresponding to positions 118-120 of SEQ ID NO: 1; ii) a GXSQG portion at positions corresponding to positions 186-190 of SEQ ID NO: 1; and iii) an HE portion at positions corresponding to positions 303-304 of SEQ ID NO: 1; and (b) at least one acyl donor substrate, said substrate being selected from the group consisting of: I) esters with the structure [X]mR5 wherein X = an ester group of the formula R6C(O)O R6 = hydrocarbyl moiety linear, branched or cyclic C1 to C7, optionally substituted with hydroxyl groups or C1 to C4 alkoxy groups, which optionally comprises one or more ether bonds for R6 = C2 to C7; R5 = a linear, branched or cyclic C1 to C6 hydrocarbyl moiety, or a five-membered cyclic heteroaromatic moiety optionally substituted with hydroxyl groups; wherein each carbon atom in R5 individually comprises at most one hydroxyl group or at most one ester group or carboxylic acid group; wherein R5 optionally comprises one or more ether bonds; M is an integer ranging from 1 to the number of carbon atoms in R5; and wherein said esters have water solubility of at least 5 ppm at 25°C; II) glycerides with the structure
wherein R1 = straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R3 and R4 are individually H or R1C(O); III) one or more formula esters
wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R2 is a C1 to C10 alkyl, alkenyl, alkynyl, aryl, alkylaryl, alkyl-heteroaryl or heteroaryl straight-chain or branched-chain, (CH2CH2O)n or (CH2CH(CH3)-O)nH, and n is from 1 to 10; and IV) acetylated saccharides selected from the group consisting of acetylated monosaccharides, acetylated disaccharides and acetylated polysaccharide; wherein, upon hydration of the hydratable adhesive film, hydrogen peroxide is released from the granular bleaching ingredient and said enzyme catalyzes the formation of an effective amount of a peracid.
[006] Other embodiments of the present invention provide a method of whitening teeth comprising providing a packaging system comprising the tooth whitening strip, in accordance with any preceding claim; remove the tooth whitening strip from the packaging system; and placing the tooth whitening strip directly in contact with the teeth for a period of time sufficient to whiten the teeth; wherein the tooth whitening strip is hydrated by moisture present in the oral cavity or tooth surface or is hydrated after step (b) but before step (c).
[007] Other areas of applicability of the present invention will be apparent from the detailed description provided below. It is to be understood that the detailed description and specific examples, while indicating the preferred embodiment of the invention, are intended for the purpose of illustration only and are not intended to limit the scope of the invention. BRIEF DESCRIPTION OF BIOLOGICAL SEQUENCES
[008] The following sequences are in accordance with 37 C.F.R. §§ 1.821-1.825 ("Requirements for Patent Applications Containing Nucleotide Sequences and/or Amino Acid Sequence Disclosures - the Sequence Rules" - "Requirements for Patent Applications Containing Nucleotide Sequences and/or Amino Acid Sequence Disclosures - the Sequence Rules " - equivalent in Portuguese) and are consistent with Standard ST.25 (2009) of the World Intellectual Property Organization (WIPO) and with the string listing requirements of the European Patent Convention (EPC) and with Regulations 5.2 and 49.5(a-bis) of the Patent Cooperation Treaty (PCT), and with Section 208 and Annex C of the Administrative Instructions. The symbols and format used for the nucleotide and amino acid sequence data are in accordance with the rules defined in 37 C.F.R. § 1,822.
SEQ ID NO: 1 is the amino acid sequence of the C277S variant perhydrolase from Thermotoga maritima.
[010] SEQ ID NO: 2 is the amino acid sequence of the fusion protein, comprising the C277S variant Thermotoga maritima perhydrolase coupled to a tooth binding domain (also known as "EZ-7" in the Publication Application International Patent No. WO2012/087970A2, to Butterick et al).
[011] SEQ ID NO: 3 is the nucleic acid sequence encoding a Bacillus subtilis ATCC® 31954™ cephalosporin C deacetylase.
[012] SEQ ID NO: 4 is the amino acid sequence of a Bacillus subtilis ATCC® 31954™ cephalosporin C deacetylase.
[013] SEQ ID NO: 5 is the amino acid sequence of a cephalosporin C deacetylase from Bacillus subtilis subsp. subtilis, strain 168.
[014] SEQ ID NO: 6 is the amino acid sequence of a B. subtilis ATCC® 6633™ cephalosporin C deacetylase.
[015] SEQ ID NO: 7 is the amino acid sequence of a cephalosporin C deacetylase from B. licheniformis ATCC® 14580™.
[016] SEQ ID NO: 8 is the amino acid sequence of an acetylxylan esterase from B. pumilus PS213.
[017] SEQ ID NO: 9 is the amino acid sequence of an acetylxylan esterase from Clostridium thermocellum ATCC® 27405™.
[018] SEQ ID NO: 10 is the amino acid sequence of an acetylxylan esterase from Thermotoga neapolitana.
[019] SEQ ID NO: 11 is the amino acid sequence of an acetylxylan esterase from Thermotoga maritima MSB8.
[020] SEQ ID NO: 12 is the amino acid sequence of an acetylxylan esterase from Thermoanaerobacterium sp. JW/SL YS485.
[021] SEQ ID NO: 13 is the amino acid sequence of a Bacillus halodurans C125 cephalosporin C deacetylase.
[022] SEQ ID NO: 14 is the amino acid sequence of a cephalosporin C deacetylase from Bacillus clausii KSM-K16.
[023] SEQ ID NO: 15 is the amino acid sequence of a variant of Thermotoga neapolitana acetylxylan esterase from U.S. Patent Application Publication No. 2010-0087529 (incorporated herein by reference in its entirety), where the Xaa residue at position 277 is Ala, Val, Ser or Thr.
[024] SEQ ID NO: 16 is the amino acid sequence of a variant of Thermotoga maritima acetylxylan esterase MSB8 from SEQ ID NO: 16 is the amino acid sequence of a variant of Thermotoga maritima acetylxylan esterase MSB8 of Patent Application Publication US No. 2010-0087529, where the Xaa residue at position 277 is Ala, Val, Ser or Thr.
[025] SEQ ID NO: 17 is the deduced amino acid sequence of an acetylxylan esterase variant of Thermotoga lettingae from U.S. Patent Application Publication No. 2010-0087529, where the Xaa residue at position 277 is Ala, Val, Ser or Thr.
[026] SEQ ID NO: 18 is the amino acid sequence of a Thermotoga petrophila acetylxylan esterase variant from U.S. Patent Application Publication No. 2010-0087529, where the Xaa residue at position 277 is Ala, Val, Ser or Thr.
[027] SEQ ID NO: 19 is the amino acid sequence of an acetylxylan esterase variant from Thermotoga sp. RQ2 derived from "RQ2(a)" of U.S. Patent Application Publication No. 2010-0087529, where the Xaa residue at position 277 is Ala, Val, Ser or Thr.
[028] SEQ ID NO: 20 is the amino acid sequence of an acetylxylan esterase variant from Thermotoga sp. RQ2 derived from "RQ2(b)" of U.S. Patent Application Publication No. 2010-0087529, where the Xaa residue at position 278 is Ala, Val, Ser or Thr.
[029] SEQ ID NO: 21 is the amino acid sequence of an acetylxylan esterase from Thermotoga lettingae.
[030] SEQ ID NO: 22 is the amino acid sequence of an acetylxylan esterase from Thermotoga petrophila.
[031] SEQ ID NO: 23 is the amino acid sequence of a first acetylxylan esterase from Thermotoga sp. RQ2 described as "RQ2(a)".
[032] SEQ ID NO: 24 is the amino acid sequence of a second acetylxylan esterase from Thermotoga sp. RQ2 described as "RQ2(b)".
[033] SEQ ID NO: 25 is the amino acid sequence of a cephalosporin C deacetylase from Thermoanearobacterium saccharolyticum.
[034] SEQ ID NO: 26 is the amino acid sequence of acetylxylan esterase from Lactococcus lactis (GENBANK® registration number ABX75634.1).
[035] SEQ ID NO: 27 is the amino acid sequence of acetylxylan esterase from Mesorhizobium loti (GENBANK® registration number BAB53179.1).
[036] SEQ ID NO: 28 is the amino acid sequence of acetylxylan esterase from Geobacillus stearothermophilus (GENBANK® registration number AAF70202.1).
[037] SEQ ID NOs: 29 to 163 are the amino acid sequences of the peptides with affinity to a surface of the oral cavity.
[038] SEQ ID NOs: 164 to 177 are the amino acid sequences of the peptide linkers/spacers. SEQ ID NOs: 178 to 197 are the amino acid sequences of various targeted perhydrolase fusion constructs comprising a perhydrolytic enzyme coupled with a peptide linker to a binding domain with affinity for an oral surface (see Publication of International Patent Application No. WO2012/087970A2 to Butterick et al). DETAILED DESCRIPTION
[039] The following description of the preferred/preferred embodiment(s) is merely exemplary in nature and is in no way intended to limit the invention, its application or uses.
[040] As used in the present invention, the articles "a", "an" and "the" that precede an element or component of the invention are intended to be non-restrictive with respect to the number of instances (ie, occurrences ) of the element or component. Therefore, "a", "an" and "the" must be read to include one or at least one, and the singular form of the word of the element or component also includes the plural, unless the number is obviously mentioned as being singular.
[041] As used in the present invention, the term "comprising" means the presence of the features, integers, steps or components defined as referred to in the claims, but this does not preclude the presence or addition of one or more other features, integers, steps, components or groups thereof. The term "comprising" is intended to include the modalities encompassed by the terms "consisting essentially of" and "consisting of". Similarly, the term "consisting essentially of" is intended to include the modalities encompassed by the term "consisting of ”.
[042] As used in this document, the term "about" modifying the amount of an ingredient or reagent used refers to the variation in numerical amount that can occur, for example, through typical measurement and liquid handling procedures used to make concentrates or use solutions in the real world; through inadvertent error in these processes; through differences in manufacture, source or purity of ingredients used to make the compositions or carry out the methods; and the like. The term "about" also encompasses values that differ due to different equilibrium conditions for a composition resulting from a particular initial blend. Claims, whether or not modified by the term "about", include equivalents to amounts.
[043] When present, all tracks are inclusive and combinable. For example, when a range from "1 to 5" is quoted, the quoted range should be interpreted as including ranges "1 to 4", "1 to 3", "1 to 2", "1 to 2 and 4 to 5", "1 to 3 and 5" and the like.
[044] As used in the present invention, the terms "substrate", "suitable substrate", "acyl donor" and "carboxylic acid ester substrate" refer, interchangeably, specifically to: (a) one or more esters of structure [X]mR5 wherein: X is an ester group of formula R6C(O)O; R6 is a linear, branched or cyclic C1 to C7 hydrocarbyl moiety, optionally substituted with a hydroxyl group or C1 to C4 alkoxy groups, wherein, optionally, R6 comprises one or more ether bonds where R6 is C2 to C7; R5 is a linear, branched or cyclic C1 to C6 hydrocarbyl moiety, or a five-membered cyclic heteroaromatic moiety or a six-membered cyclic aromatic or heteroaromatic moiety optionally substituted with a hydroxyl group; wherein each carbon atom in R5 individually comprises at most one hydroxyl group or at most one ester group, and wherein R5 optionally comprises one or more ether bonds; m is an integer ranging from 1 to the number of carbon atoms in R5, said one or more esters having water solubility of at least 5 ppm at 25 °C; or (b) one or more glycerides with the structure
wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R3 and R4 are individually H or R1C(O); or (c) one or more formula esters
wherein R1 is a straight chain or branched chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R2 is a straight chain or branched chain C1 to C10 alkyl, heteroaryl or heteroaryl, (CH2CH2O )n or (CH2CH(CH3)-O)nH, and n is from 1 to 10; or (d) one or more acetylated monosaccharides, acetylated disaccharides or acetylated polysaccharides; or (e) any combination of (a) through (d).
[045] As used in the present invention, the term "peracid" is synonymous with peroxyacid, peroxycarboxylic acid, peroxy acid, percarboxylic acid and peroxoic acid.
[046] As used in the present invention, the term "peracetic acid" is abbreviated as "PAA" and is synonymous with peroxyacetic acid, ethanoperoxoic acid and all other synonyms of CAS registry number 79-21-0.
[047] As used in the present invention, the term "monoacetin" is synonymous with glycerol monoacetate, glycerin monoacetate and glyceryl monoacetate.
[048] As used in the present invention, the term "diacetin" is synonymous with glycerol diacetate; glycerin diacetate, glyceryl diacetate and all other synonyms for CAS Registry Number 25395-31-7.
[049] As used in the present invention, the term "triacetin" is synonymous with glycerin triacetate; glycerol triacetate; glyceryl triacetate, 1,2,3-triacetoxypropane; 1,2,3-propanetriol triacetate and all other synonyms of CAS Registry Number 102-76-1.
[050] As used in the present invention, the terms "acetylated sugar" and "acetylated saccharide" refer to mono, di and polysaccharides, comprising at least one acetyl group. Examples include, but are not limited to, glucose pentaacetate; xylose tetraacetate; acetylated xylan; acetylated xylan fragments; P-D-ribofuranose-1,2,3,5-tetraacetate; tri-O-acetyl-D-galactal; and tri-O-acetyl-glycal.
[051] As used in the present invention, "hydrocarbyl", "hydrocarbyl group" and "hydrocarbyl moiety" are intended to mean a straight-chain, branched or cyclic arrangement of carbon atoms linked by bonds between single, double or triple carbons and/or by ether bonds, and therefore substituted with hydrogen atoms. Such hydrocarbyl groups can be aliphatic or aromatic. Examples of hydrocarbyl groups include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, t-butyl, cyclopropyl, cyclobutyl, pentyl, cyclopentyl, methylcyclopentyl, hexyl, cyclohexyl, benzyl and phenyl. In a preferred embodiment, the hydrocarbyl moiety is an array of linear, branched or cyclic carbon atoms connected by simple carbon-carbon bonds and/or by ether bonds, and therefore substituted with hydrogen atoms.
[052] As used in the present invention, propanediol; 1,3-propanediol; 1,2-butanediol; 1,3-butanediol; 2,3-butanediol; 1,4-butanediol; 1,2-pentanediol; 2,5-pentanediol; 1,5-pentandiol; 1,6-pentanediol; 1,2-hexanediol; 2,5-hexanediol; 1,6-hexanediol; and mixtures thereof, refer to said compounds comprising at least one ester group of the formula RC(O)O, where R is a linear C1 to C7 hydrocarbyl moiety. In one embodiment, the carboxylic acid ester substrate is selected from the group consisting of propylene glycol diacetate (PGDA), ethylene glycol diacetate (EDGA) and mixtures thereof.
[053] As used in the present invention, the term "propylene glycol diacetate" is synonymous with 1,2-diacetoxypropane, propylene diacetate; 1,2-propanediol diacetate and all other synonyms of CAS Registry Number 623-84-7.
[054] As used in the present invention, the term "ethylene glycol diacetate" is synonymous with 1,2-diacetoxyethane, ethylene diacetate, glycol diacetate and all other synonyms of CAS registry number 111-557.
[055] As used in the present invention, the terms "suitable enzymatic reaction mixture", "components suitable for in situ generation of a peracid", "suitable reaction components", "suitable aqueous reaction mixture", "reaction mixture", and " Peracid Generating Components” refer to the materials and water (from saliva and/or user applied to the hydratable adhesive film prior to use) in which the reactants and the perhydrolytic enzyme catalyst come into contact. The peracid generating components will include at least enzyme with perhydrolytic activity, preferably wherein the perhydrolytic enzyme is at least one CE-7 perhydrolase (optionally in the form of a fusion protein directed to a body surface) , at least one suitable carboxylic acid ester substrate, a source of peroxygen and water (from saliva and/or user applied to hydratable adhesive film prior to use).
[056] As used in the present invention, the term "perhydrolysis" is defined as the reaction of a selected substrate with peroxide to form a peracid. Typically, inorganic peroxide reacts with the selected substrate in the presence of a catalyst to produce the peroxycarboxylic acid. As used herein, the term "chemical perhydrolysis" includes perhydrolysis reactions in which a substrate (a precursor of peroxycarboxylic acid) is combined with a source of hydrogen peroxide, in which the peroxycarboxylic acid is formed in the absence of an enzyme catalyst. As used herein, the term "enzymatic perhydrolysis" includes perhydrolysis reactions in which a carboxylic acid ester substrate (a peracid precursor; the acyl donor) is combined with a source of hydrogen peroxide and water, whereby the enzymatic catalyst catalyzes the formation of peracid.
[057] As used in the present invention, the term "perhydrolase activity" refers to the activity of the catalyst per unit mass (e.g., milligram) of protein, dry cell weight or weight of immobilized catalyst.
[058] As used in the present invention, "one unit of enzymatic activity" or "one unit of activity" or "U" is defined as the amount of perhydrolase activity required to produce 1 μmol of peroxycarboxylic acid product per minute , at a specified temperature.
[059] As used in the present invention, the terms "enzyme catalyst" and "perhydrolase catalyst" refer to a catalyst that comprises an enzyme with perhydrolysis activity and may be in the form of an entire microbial cell, permeabilized microbial cell(s), one or more cellular components of a microbial cell extract, partially purified enzyme, or purified enzyme. The enzymatic catalyst can also be chemically modified (such as by pegylation or by reaction with crosslinking reagents). The perhydrolase catalyst can also be immobilized on a soluble or insoluble support, using methods well known to those skilled in the art; see, for example, Immobilization of Enzymes and Cells; Gordon F. Bickerstaff, Editor; Humana Press, Totowa, NJ, USA; 1997. In one embodiment, the perhydrolase catalyst can be non-covalently immobilized in or on an oral care strip (eg, a whitening strip) or dental tray. In a further embodiment, non-covalent immobilization to the dental strip or tray can be through the use of a peptide binding domain with strong affinity for a material in or on the strip or tray (e.g., a fusion protein comprising a perhydrolytic enzyme coupled via an optional peptide spacer to a peptide binding domain). In another embodiment, the dental tray is a deformable tray. In yet another embodiment, the perhydrolase catalyst is immobilized in or on the deformable tray after the formation of the dental impression.
[060] As used in the present invention, "acetylxylan esterases" refers to an enzyme (E.C. 3.1.1.72; AXEs) that catalyzes the deacetylation of acetylated xylans and other acetylated saccharides.
[061] As used in the present invention, the terms "cephalosporin C deacetylase" and "cephalosporin C acetylhydrolase" refer to an enzyme (EC 3.1.1.41) that catalyzes the deacetylation of cephalosporins such as cephalosporin C and acid 7-aminocephalosporan (Mitsushima et al. (1995) Appl. Env. Microbiol. 61(6):2224-2229). The amino acid sequences of several cephalosporin C deacetylases with significant perhydrolytic activity are provided in the present invention.
[062] As used in the present invention, the term "Bacillus subtilis ATCC® 31954™" refers to a bacterial cell deposited in the American Cell Culture Collection (ATCC) which has the international deposit registration number ATCC® 31954™ . As described in the present invention, an enzyme with significant perhydrolase activity from B. subtilis ATCC® 31954™ is provided as SEQ ID NO: 4 (see U.S. Patent Application Publication No. 2010-0041752).
[063] As used in the present invention, the term "Thermotoga maritima MSB8" refers to a bacterial cell reported to have acetylxylan esterase activity (GENBANK® NP_227893.1; see US Patent Application Publication No. 2008- 0176299). The amino acid sequence of the enzyme with perhydrolase activity from Thermotoga maritima MSB8 is provided as SEQ ID NO: 11. Variants of the Thermotoga maritima perhydrolase MSB8 are provided as SEQ ID NOs: 1 and 16.
[064] As used in the present invention, an "isolated nucleic acid molecule", "isolated polynucleotide" and "isolated nucleic acid fragment" will be used interchangeably and refer to a polymer of RNA or DNA that is stranded single or double, optionally containing synthetic, artificial or altered nucleotides. An isolated nucleic acid molecule in the form of a DNA polymer can be composed of one or more segments of cDNA, genomic DNA, or synthetic DNA.
[065] The term "amino acid" refers to the basic chemical structural unit of a protein or polypeptide. The following abbreviations are used in the present invention to identify specific amino acids:


[066] As used in the present invention, the term "about" modifying the amount of an ingredient or reagent used refers to the variation in the numerical amount that can occur, for example, through typical measurement and liquid handling procedures used to make concentrates or, as used in the present invention, the terms "signature portion" and "diagnostic portion" refer to conserved structures shared between a family of enzymes with a defined activity. The signature portion can be used to define and/or identify a family of structurally related enzymes with similar enzymatic activity for a defined family of substrates. The signature portion can be a single contiguous amino acid sequence or a collection of non-contiguous conserved portions that together form the signature portion. Typically, the conserved portion(s) is/are represented by an amino acid sequence. In one embodiment, the perhydrolytic enzymes used in the present compositions and methods comprise a signature portion of carbohydrate esterase CE-7.
[067] As used in the present invention, the term "sequence analysis software" refers to any software program or computational algorithm that is useful for the analysis of nucleotide or amino acid sequences. "Sequence analysis software" can be commercially available or independently developed. Typical sequence analysis software will include, but not be limited to, the GCG software package (Wisconsin Package Version 9.0, Accelrys Software Corp., San Diego, CA), BLASTP, BLASTN, BLASTX (Altschul et al, J. Mol. Biol. 215:403-410 (1990)), and DNASTAR (DNASTAR, Inc. 1228 S. Park St. Madison, WI 53715 USA), CLUSTALW (e.g., version 1.83; Thompson et al, Nucleic Acids Research, 22 (22):4673-4680 (1994)), and the FASTA program incorporating the Smith-Waterman algorithm (WR Pearson, Comput. Methods Genome Res., [Proc. Int. Symp.] (1994), Meeting Date 1992, 111-20 Editor(s): Suhai, Sandor Publisher: Plenum, New York, NY), Vector NTI (Informax, Bethesda, MD) and Sequencher v. 4.05. Within the context of this application, it will be understood that where sequence analysis software is used for analysis, analysis results will be based on "default values" of the referenced program, unless otherwise specified. As used herein, "default values" means any set of values or parameters defined by the software manufacturer that are originally loaded with the software when it is first started.
[068] The term "body surface" refers to the entire surface of the human body that can serve as the target for a benefit agent, such as a peracid benefit agent. The present methods and compositions are directed to oral care products and applications. As such, the body surface comprises a material/surface of the oral cavity. In one embodiment, the material in the oral cavity comprises tooth enamel.
[069] As used herein, the terms "tooth whitening" and "tooth whitening" are used interchangeably to refer to improving the brightness (eg, whitening) of a tooth or teeth. Whitening strips are described in the present invention comprising ingredients suitable for enzymatically generating an effective amount of a peracid to whiten teeth when hydrated.
[070] As used in the present invention, "intrinsic stains" on teeth refers to the resulting color of chromogens within the enamel and underlying dentin. The intrinsic color of human teeth tends to turn yellower with age, due to thinning of the enamel and darkening of the underlying yellow dentin. Removal of intrinsic stain often requires the use of peroxides or other oxidizing chemicals, which penetrate the enamel and discolor internal chromogens.
[071] Unlike intrinsic stains, "extrinsic stains" form on the surface of teeth when exogenous chromogenic materials bind to enamel, usually within the film that naturally coats the teeth. Most people accumulate some degree of unsightly extrinsic stains on their teeth over time. This coloring process is promoted by factors such as: (1) intake of foods and beverages that contain tannins such as coffee, tea or red wine; (2) the use of tobacco products; and/or (3) exposure to certain cationic substances (eg, tin, iron and chlorhexidine). These substances tend to adhere to the hydroxyapatite structure of the enamel, which leads to tooth discoloration and a concomitant reduction in tooth whiteness. Over a period of years, extrinsic stains can penetrate the enamel layer and result in intrinsic stains.
[072] As used in the present invention, the term "stain removal" refers to the process of removing a stain from a surface of the oral cavity. The stain(s) can be intrinsic stains, extrinsic stains or a combination of these.
[073] As used in the present invention, "effective amount of perhydrolase enzyme" refers to the amount of perhydrolase enzyme needed to achieve the enzyme activity required in the specific application. Such effective amounts are readily recognized by one of skill in the art and are based on many factors, such as the variant of the particular enzyme used.
[074] As used herein, the term "peroxygen source" refers to compounds capable of providing hydrogen peroxide at a concentration of about 1 mM or more when in an aqueous solution including, but not limited to, to hydrogen peroxide, hydrogen peroxide adducts (eg urea-hydrogen peroxide adduct (carbamide peroxide)), perborates and percarbonates. As described in the present invention, the source of peroxygen in the present whitening strips is in the form of granular particles, where the user hydrates the granular peroxide particles to release an effective amount of hydrogen peroxide. As described in the present invention, the concentration of hydrogen peroxide provided by the peroxide compound in the aqueous reaction formulation is initially equal to at least 0.1 mM or more, after combining the reaction components. In one embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to at least 0.5 mM. In one embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to at least 1 mM. In one embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to at least 10 mM. In one embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to at least 100 mM. In one embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to at least 200 mM. In one embodiment, the hydrogen peroxide concentration in the aqueous reaction formulation is equal to 500 mM or more. In yet another embodiment, the concentration of hydrogen peroxide in the aqueous reaction formulation is equal to 1000 mM or more. The molar ratio of hydrogen peroxide to enzyme substrate, eg triglyceride, (H2O2:substrate) in the formulation may be from about 0.002 to 20, preferably from about 0.1 to 10 and most preferably from about 0 .5 to 5.
[075] As used in the present invention, the term "oligosaccharide" refers to compounds containing between 2 and at least 24 monosaccharide units joined by glycosidic bonds. The term "monosaccharide" refers to a compound of the empirical formula (CH2O)n, where n > 3, the carbon skeleton is unbranched, each carbon atom except one contains a 1 hydroxyl group and the remaining carbon atom is an aldehyde or a ketone at carbon atom 1. The term "monosaccharide" also refers to an intracellular cyclic hemiacetal or hemiacetal forms.
[076] As used in the present invention, the term "hydratable adhesive" refers to an adhesive material capable of being hydrated. The hydratable adhesive is substantially dry and non-adhesive until hydrated. After hydration, the hydratable adhesive becomes adhesive enough to bond the tooth whitening strip/film to the surface of a tooth. The hydratable adhesive film also comprises a granular whitening ingredient, whereby, after hydration, an effective amount of hydrogen peroxide is released to be used in the enzymatic formation of a peracid bleaching agent. The whitening strip/film is generally thin (usually less than 2 mm), shaped and sized to fit within the oral cavity, and flexible enough so that the film and can be applied and placed in contact with a plurality of teeth, whereby the hydrated adhesive helps to hold the film/strip on the tooth surface and provide ion a sufficient amount of time for the peracid whitening agent to whiten teeth.
[077] As used in the present invention, the term "effective amount" will refer to the amount of material needed to achieve the desired effect.
[078] As used in the present invention, the term "substantially non-adhesive until hydrated" will refer to the lack of sufficient adhesion strength to adhere the tooth whitening film to the surface of a plurality of teeth prior to hydration. hydratable adhesive film will be easy to handle and handle prior to application/moisturizing by the user.
[079] By "sequence identity" is meant an amino acid identity using a sequence alignment program, for example, ClustalW or BLAST, for example, generally as described in Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ, "Basic local alignment search tool", J Mol Biol (1990) 215 (3): 403-410 and Goujon M, Mc William H, Li W, Valentin F, Squizzato S, Parern J, Lopez R, Nucleic Acids Research (2010) 38 Suppl: W695-9.
[080] Acyl donors for use in the present invention, for example, to form peracids after reaction with peroxide, are selected from one or more of (i) C2-18 carboxylic acids, e.g., C2-carboxylic acids 6 (for example acetic acid), including linear or branched lower alkylcarboxylic acids, optionally substituted with hydroxy and/or C1-4 alkoxy; (ii) hydrolyzable and acceptable esters thereof (eg mono, di and triglycerides and acylated saccharides) and (iii) mixtures thereof. For example, acyl donors include 1,2,3-triacetoxypropane (sometimes referred to in the present invention as triacetin or glycerin triacetate) and acylated saccharides, e.g., acetylated saccharides. In a particular embodiment, esters for such use may, for example, be esters with water solubility equal to at least 5 ppm at 25°C.
[081] Acyl and/or enzyme donors can optionally be encapsulated. There are a variety of natural and synthetic encapsulation options well known in the art. Modified starches and gum arabic are particularly well suited, as they are food grade, relatively inexpensive, quick to dissolve and can absorb very high levels of liquid oils. Any impact on final viscosity needs to be considered.
[082] In some embodiments, the granules comprise an antisensitivity agent capable of desensitizing the nerves or occluding the dentinal tubules. In some embodiments, the antisensitivity agent is selected from a potassium ion source, a silicate, a stannous ion source, a basic amino acid, a clay, and a combination thereof. In some embodiments, the source of potassium ions is an orally acceptable potassium salt and is present in an amount effective to reduce dentinal sensitivity. In some embodiments, the source of potassium ions is selected from potassium chloride, potassium nitrate and a combination thereof. In some embodiments, the basic amino acid is arginine. In some embodiments, the basic amino acid is selected from arginine phosphate, arginine bicarbonate, and arginine hydrochloride. In some embodiments, the silicate is calcium silicate. Perhydrolases CE-7
[083] The present compositions and method comprise enzymes with perhydrolytic activity that are structurally classified as members of the carbohydrate family of the esterase 7 family (CE-7 family) of enzymes (see Coutinho, PM, Henrissat, B. approach" in Recent Advances in Carbohydrate Bioengineering, HJ Gilbert, G. Davies, B. Henrissat and B. Svensson eds., (1999) The Royal Society of Chemistry, Cambridge, pp. 3-12.) The CE-7 family of enzymes demonstrated be particularly effective for the production of peroxycarboxylic acids from a variety of carboxylic acid ester substrates in combination with a source of peroxygen (U.S. Patent Nos. 7,794,378; 7,951,566; 7,723,083; and 7,964. 378 and U.S. Patent Application Publication Nos. 2008-0176299, 2010-0087529, 2011-0081693, and 2011-0236335, owned by DiCosimo et al.; each incorporated herein by reference).
[084] Members of the CE-7 family include cephalosporin C deacetylases (CAHs; E.C. 3.1.1.41) and acetylxylan esterases (AXEs; E.C. 3.1.1.72). Members of the CE-7 esterase family share a conserved signature portion (Vincent et al., J. Mol. Biol., 330:593-606 (2003)). Perhydrolases which comprise the CE-7 signature portion ("CE-7 perhydrolases") and/or a substantially similar structure, are suitable for use in the compositions and methods described in the present invention. Means to identify substantially similar biological molecules are well known in the art (for example, sequence alignment protocols, nucleic acid hybridizations and/or the presence of a conserved signature portion). In one aspect, the perhydrolase includes an enzyme comprising the CE-7 signature portion and at least 20%, preferably at least 30%, more preferably at least 33%, more preferably at least 40%, most preferably at least 42%, more preferably at least 50%, more preferably at least 60%, more preferably at least 70%, more preferably at least 80%, more preferably at least 90% and most preferably at least 90%, 91%, 92% , 93%, 94%, 95%, 96%, 97%, 98% or 99% amino acid identity to one of the sequences given herein.
[085] As used in the present invention, the phrase "enzyme is structurally classified as an enzyme CE-7", "perhydrolase CE-7" or "structurally classified as an enzyme of the carbohydrate esterase 7 family" will be used to refer to to enzymes with perhydrolytic activity, which are structurally classified as carbohydrate esterase CE-7. This family of enzymes can be defined by the presence of a signature moiety (Vincent et al, supra). - 7 comprises three conserved portions (residue position numbering relative to the reference sequence SEQ ID NO: 1; a C277S variant of Thermotoga maritima perhydrolase). Arg118-Gly119-Gln120; Gly186-Xaa187-Ser188-Gln189-Gly190 and His303-Glu304.
[086] Typically, the Xaa at amino acid residue position 187 is glycine, alanine, proline, tryptophan, or threonine. Two of the three amino acid residues belonging to the catalytic triad are in bold. In one embodiment, the Xaa at amino acid residue position 187 is selected from the group consisting of glycine, alanine, proline, tryptophan and threonine.
[087] Further analyzes of the conserved portions in the CE-7 carbohydrate esterase family indicate the presence of an additional conserved portion (LXD at amino acid positions 272-274 of SEQ ID NO: 1) that can be used to further define a per- hydrolase belonging to the carbohydrate esterase family CE-7. In a further embodiment, the signature portion defined above may include an additional (fourth) conserved portion, defined as: Leu272-Xaa273-Asp274. The Xaa at amino acid residue position 273 is typically methionine, isoleucine or valine. The fourth portion includes the aspartic acid residue (bold) belonging to the catalytic triad (Ser188-Asp274-His303).
[088] The CE-7 perhydrolases can be in the form of fusion proteins with at least one peptide component having affinity for at least one body surface. In one embodiment, all alignments used to determine whether a targeted perhydrolase (fusion protein) comprises the CE-7 signature portion will be based on the amino acid sequence of the perhydrolytic enzyme without the peptide component having affinity for a surface body.
[089] A variety of well-known global alignment algorithms (ie, sequence analysis software) can be used to align two or more amino acid sequences representing enzymes with perhydrolase activity to determine if the enzyme comprises the present portion. of subscription. The aligned sequence(s) is/are compared with the reference sequence (SEQ ID NO: 1) to determine the existence of a signature portion. In one embodiment, a CLUSTAL alignment (such as CLUSTALW) using a reference amino acid sequence (as used in the present invention, the perhydrolase sequence (SEQ ID NO: 1)) is used to identify perhydrolases belonging to the CE family. -7 esterase. The relative numbering of conserved amino acid residues is based on numbering the reference amino acid sequence to account for small insertions or deletions (e.g., typically five amino acids or less) within the aligned sequence.
[090] Examples of other suitable algorithms that can be used to identify sequences comprising the present signature portion (when compared to the reference sequence) include, but are not limited to, that of Needleman and Wunsch (J. Mol. Biol. 48, 443-453 (1970); the global alignment tool) and that of Smith-Waterman (J. Mol. Biol. 147: 195-197 (1981); the local alignment tool). In one embodiment, a Smith-Waterman alignment is implemented using predefined parameters. An example of suitable predefined parameters include using a BLOSUM62 scoring matrix with an opening gap penalty = 10 and an extension gap penalty = 0.5.
[091] In one embodiment, suitable perhydrolases include enzymes comprising the CE-7 signature portion and at least 20%, preferably at least 30%, 33%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% amino acid identity with SEQ ID NO: 1.
[092] Examples of CE-7 carbohydrate esterases with perhydrolytic activity include, but are not limited to, enzymes with an amino acid sequence such as SEQ ID NOs: 1 and 4 to 28. In one embodiment, the enzyme comprises a sequence of amino acids selected from the group consisting of 1, 10, 11, 15 and 16.
[093] As used in the present invention, the term "variant CE-7", "variant perhydrolase" or "variant" will refer to CE-7 perhydrolases having a genetic modification that results in at least one addition, deletion and/or amino acid substitution compared to the corresponding enzyme (usually the wild-type enzyme) from which the variant was derived; as long as the CE-7 signature portion and associated perhydrolytic activity are maintained. CE-7 variant perhydrolases can also be used in the present compositions and methods. Examples of CE-7 variants are provided as SEQ ID NOs: 1, 15, 16, 17, 18, 19 and 20. In one embodiment, variants may include SEQ ID NOs: 1 and 16.
[094] One of skill in the art recognizes that substantially similar CE-7 perhydrolase sequences (while retaining the signature moieties) may also be used in the present compositions and methods. In one embodiment, substantially similar sequences are defined as to their ability to hybridize, under highly stringent conditions, to the nucleic acid molecules associated with the sequences exemplified in the present invention. In another embodiment, sequence alignment algorithms can be used to define substantially similar enzymes based on percent identity with the DNA or amino acid sequences provided in the present invention.
[095] As used in the present invention, a nucleic acid molecule is "hybridizable" to another nucleic acid molecule, such as a cDNA, genomic DNA or RNA, when a single strand of the first molecule can anneal with another molecule under suitable conditions of temperature and strength of ionic solution. Hybridization and washing conditions are well known and exemplified in Sambrook, J. and Russell, D., T. Molecular Cloning: A Laboratory Manual, Third Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (2001). The conditions of temperature and ionic strength determine the “stringency” of the hybridization. Stringency conditions can be adjusted to search for moderately similar molecules, such as homologous sequences from distantly related organisms to highly similar molecules, such as genes that duplicate the functional enzymes of closely related organisms. Post-hybridization washes typically determine stringency conditions. One set of preferred conditions uses a series of washes starting with 6x SSC, 0.5% SDS at room temperature for 15 min, then repeated with 2x SSC, 0.5% SDS at 45°C for 30 min and then , repeated twice with 0.2x SSC, 0.5% > SDS at 50°C for 30 min. A more preferred set of conditions uses higher temperatures, where the washes are identical to those described above, except that the temperature of the two final 30 min washes in 0.2x SSC, 0.5% > SDS has increased to 60 °C. Another preferred set of highly stringent hybridization conditions is 0.1x SSC, 0.1% SDS at 65°C and washed with 2x SSC, 0.1% SDS, followed by a final wash of 0.1x SSC, 0 0.1% SDS at 65°C.
[096] Hybridization requires that the two nucleic acids contain complementary sequences, although depending on the stringency of the hybridization, incompatibilities between bases can occur. The stringency suitable for hybridizing nucleic acids depends on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the greater the Tm value for nucleic acid hybrids with those sequences. The relative stability (corresponding to the highest Tm) of nucleic acid hybridizations decreases in the following order: RNA:RNA, DNA:RNA, DNA:DNA. For hybrids greater than 100 nucleotides in length, equations to calculate Tm have been derived (Sambrook and Russell, supra). For hybridizations with shorter nucleic acids, i.e., oligonucleotides, the position of the mismatches becomes more important, and the length of the oligonucleotide determines its specificity (Sambrook and Russell, supra). In one aspect, the length of a hybridizable nucleic acid is at least about 10 nucleotides. Preferably, a minimum length for a hybridizable nucleic acid is equal to at least about 15 nucleotides in length, more preferably equal to at least about 20 nucleotides in length, even more preferably equal to at least 30 nucleotides in length, even more preferably equals at least 300 nucleotides in length and more preferably equals at least 800 nucleotides in length. In addition, one skilled in the art will recognize that the temperature and saline concentration of the wash solution can be adjusted as needed, according to factors such as the length of the probe.
[097] As used in the present invention, the term "percent identity" is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, "identity" also means the degree of sequence relatedness between the polypeptide or polynucleotide sequences, as the case may be, as determined by the match between the strands of such sequences. "Identity" and "similarity" can be easily calculated by known methods, including, but not limited to, those described in: Computational Molecular Biology, Lesk, A.M., ed.) Oxford University Press, NY (1988); Biocomputing: Informatics and Genome Projects (Smith, D.W., ed.) Academic Press, NY (1993); Computer Analysis of Sequence Data, Part I (Griffin, A.M., and Griffin, H.G., eds.) Humana Press, NJ (1994); Sequence Analysis in Molecular Biology (von Heinje, G., ed.) Academic Press (1987); and Sequence Analysis Primer (Gribskov, M. and Devereux, J., eds.) Stockton Press, NY (1991). Methods to determine identity and similarity are encoded in publicly available computer programs. Sequence alignment and percent identity calculations can be performed using the Megalign program from the LASERGENE bioinformatics computing solution (DNASTAR Inc., Madison, WI), the Vector NTI v. AlignX program. 7.0 (Informax, Inc., Bethesda, MD), or the EMBOSS Open Software Package (EMBL-EBI; Rice et al, Treds in Genetics 16, (6): 276-277 (2000)). Various sequence alignments can be performed using the CLUSTAL method (such as CLUSTAL W; e.g., version 1.83) of the alignment (Higgins and Sharp, CABIOS, 5:151-153 (1989); Higgins et al., Nucleic Acids Res. 22: 4673-4680 (1994); and Chenna et al., Nucleic Acids Res 31 (13): 3497-500 (2003)), available from the European Molecular Biology Laboratory through the European Bioinformatics Institute) with default parameters . Suitable parameters for CLUSTAL W protein alignments include gap existence feather = 15, gap length = 0.2, matrix = Gonnet (eg Gonnet250), ENDGAP protein = -1, GAPDIST protein = 4, and KTUPLE = 1 In one modality, a fast or slow alignment is used with the default settings where a slow alignment is preferred. Alternatively, parameters using the CLUSTALW method (eg version 1.83) can be modified to also use KTUPLE = 1, gap penalty = 10, gap length = 1, matrix = BLOSUM (eg BLOSUM64), WINDOW = 5 and TOP DIGONALS SAVED = 5.
[098] In one aspect, isolated nucleic acid molecules encode a polypeptide that has an amino acid sequence that is at least 20%, preferably at least 30%, 33%, 40%, 50%, 60%, 70%, 80 %, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the amino acid sequences indicated herein. In another aspect, isolated nucleic acid molecules encode a polypeptide that has an amino acid sequence that is at least about 20%>, preferably at least 30%, 33%, 40%, 50%, 60%, 70%, 80 %, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%> identical to the amino acid sequences indicated herein. Suitable nucleic acid molecules not only have the above homologies, but also typically encode a polypeptide that is about 210 to 340 amino acids long, about 300 to about 340 amino acids, preferably about 310 to about 330 amino acids, and more preferably, about 318 to about 325 amino acids in length, wherein each polypeptide is characterized as having perhydrolytic activity. Directed perhydrolases
[099] As used in the present invention, the term "targeted perhydrolase" and "targeted enzyme with perhydrolytic activity" will refer to fusion proteins that comprise at least one perhydrolytic enzyme (wild type or variant thereof) fused/coupled to at least one peptide component with affinity for a targeted surface, preferably a targeted body surface. The perhydrolytic enzyme in the targeted perhydrolase can be any CE-7 carbohydrate esterase with perhydrolytic activity. The CE-7 perhydrolase can be identified by the presence of the CE-7 signature portion that aligns with a reference sequence SEQ ID NO: 1, said signature portion comprising: i) an RGQ motif portion at positions corresponding to the positions 118-120 of SEQ ID NO: 1; ii) a GXSQG portion at positions corresponding to positions 186-190 of SEQ ID NO: 1; and iii) an HE portion at positions corresponding to positions 303-304 of SEQ ID NO: 1; and
[100] In one embodiment, perhydrolytic enzymes can be those that have an amino acid sequence that is equal to at least about 20%, preferably at least 30%, 33%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to any of the amino acid sequences given herein (or that is, SEQ ID NOs: 1 and 4 to 28).
[101] In another embodiment, the fusion protein comprises a perhydrolytic enzyme that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 and 4 to 28.
[102] As used in the present invention, the terms "peptide component", "peptide component having affinity for a surface of the oral cavity", "binding domain of the oral cavity" and "OCBD" shall refer to the component of the fusion protein that it is not part of the perhydrolytic enzyme which comprises at least one polymer of two or more amino acids joined by a peptide bond; wherein the component has affinity for the surface of the target oral cavity. In a preferred aspect, OCBD has an affinity for tooth enamel.
[103] In one embodiment, the peptide component with affinity for a body surface can be an antibody Fab, a single-chain variable fragment (scFv) or a Camelidae antibody (Muyldermans, S., Rev. Mol. Biotechnol. ( 2001) 74:277-302) ), a non-antibody structure display protein ( Hosse et al., Prot. Sci. (2006) 15(1): 14-27 and Binz, H. et al. (2005) Nature Biotechnology 23, 1257-1268 for a review of various framework-assisted approaches) or a single-chain polypeptide without an immunoglobulin fold. In another aspect, the peptide component having affinity for the tissue/surface of the oral cavity (such as tooth enamel) is a single-chain peptide without an immunoglobulin fold.
[104] The peptide component having affinity for a surface of the oral cavity can be separated from the perhydrolytic enzyme by an optional peptide ligand. Certain peptide linkers/spacers are 1 to 100 or 1 to 50 amino acids in length. In some embodiments, the peptide spacers are from about 1 to about 25, from 3 to about 40, or from 3 to about 30 amino acids in length. In other embodiments, they are spacers that are from about 5 to about 20 amino acids in length. Various peptide linkers can be used. In one embodiment, at least one peptide ligand is present and can be repeated up to 10 times.
[105] In one embodiment, the fusion peptide comprises at least one oral cavity surface binding peptide selected from the group consisting of SEQ ID NOs: 178 to 197.
[106] In another embodiment, the target surface is a material that is part of the packaging, such as the whitening strip or polymeric backing layer (when using a polymeric backing layer to which the hydratable adhesive is applied) and/or the method of delivery to the oral cavity. The peptide component is selected for its affinity with a material or materials in use, such as films, plastics and polymers. The targeted perhydrolase fusion protein design allows for controlled release and removal of perhydrolase from the user by holding it in a removable device such as, but not limited to, a tray or buccal strip.
[107] The peptide component having affinity for a surface of the oral cavity can be separated from the CE-7 perhydrolase by an optional peptide ligand. Certain peptide linkers/spacers are 1 to 100 or 1 to 50 amino acids in length. In some embodiments, the peptide spacers are from about 1 to about 25, from 3 to about 40, or from 3 to about 30 amino acids in length. In other embodiments, they are spacers that are from about 5 to about 20 amino acids in length. Various peptide linkers can be used. Examples of peptide linkers are provided as SEQ ID NOs: 164 to 177.
[108] As such, examples of targeted CE-7 perhydrolases may include, but are not limited to, any of the CE-7 perhydrolases having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 and 4 to 28, coupled to a peptide component having affinity for a surface of the oral cavity. In a preferred embodiment, examples of target perhydrolases may include, but are not limited to, any of the CE-7 perhydrolases having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 4, 5, 6 , 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 and 28 coupled to one or more peptides of binding to the body surface with affinity for an oral cavity surface (optionally through a peptide spacer). In a preferred embodiment, the targeted perhydrolase comprises a CE-7 perhydrolase having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 and 16.
[109] In one embodiment, the perhydrolase is a CE-7 perhydrolase in the form of a fusion protein that has the following general structure: PAH-[L]y-OCBD or OCBD-[L]y- PAH where PAH is the enzyme that has perhydrolytic activity, eg with a CE-7 signature moiety, eg SEQ ID NO: 1, and OCBD is a peptide component having affinity for a surface of the oral cavity; and L is an optional linker; and y is an integer ranging from 0 to 10. In one embodiment, linker (L) is present and is a peptide linker ranging from 1 to 100 amino acids in length.
[110] For example SEQ ID NO: 2 is a fusion protein which has a perhydrolase sequence of SEQ ID NO: 1 coupled to a C-terminal targeting domain with an affinity for oral tissues.
[111] Perhydrolases for use in the products and methods of the invention may be in free, protected (e.g., acetylated) or salt form.
[112] In another embodiment, the target surface is a material that is part of the packaging and/or delivery to the oral cavity. The peptide component is selected for its affinity with a material or materials in use, such as films, plastics and polymers. The CE-7 targeted perhydrolase fusion protein design allows for controlled release and removal of perhydrolase from the user by holding it in a removable device such as, but not limited to, a tray or buccal strip. Link Affinity
[113] The peptide component having an affinity for the oral cavity surface comprises a binding affinity for an oral cavity surface of 10-5 molar (M) or less. In certain embodiments, the peptide component is one or more oral cavity surface binding peptides and/or binding domain(s) having a binding affinity of 10-5 molar (M) or less for tooth enamel. In some embodiments, the binding peptides or domains will have a binding affinity value of 10-5 M or less in the presence of at least about 50 to 500 mM salt. The term "binding affinity" refers to the strength of interaction of a binding peptide with its respective substrate. Binding affinity can be defined or measured in terms of the dissociation constant of the binding peptide ("KD"), or "MB50."
[114] "KD" corresponds to the concentration of the peptide at which the binding site on the target is half occupied, that is, when the concentration of the target with bound peptide (bound target material) is equal to the concentration of target without bound peptide. The smaller the dissociation constant, the more tightly the peptide is bound. For example, a peptide with a nanomolar dissociation constant (nM) binds more tightly than a peptide with a micromolar dissociation constant (μM). Certain embodiments of the invention will have a KD value of 10-5 or less.
[115] "MB50" refers to the concentration of binding peptide that provides a signal that is equal to 50% of the maximum signal obtained in an ELISA-based binding assay. See, for example, example 3 of U.S. Patent Application Publication 2005/022683; hereby incorporated by reference. The MB50 provides an indication of the strength of the binding interaction or affinity of the components of the complex. The lower the MB50 value, the stronger, ie “better” is the interaction of the peptide with its corresponding substrate. For example, a peptide with a nanomolar MB50 (nM) binds more tightly than a peptide with a micromolar MB50 (μM) . Certain embodiments of the invention will have an MB50 value of 10-5 or less.
[116] In some embodiments, the peptide component having affinity for a surface of the oral cavity may have a binding affinity, as measured by KD or MB50 values, less than or equal to about 10-5 M, less than or equal to about 10-6 M, less than or equal to about 10-7 M, less than or equal to about 10-8 M, less than or equal to about 10-9 M, or less than or equal to about 10-10 M.
[117] In some embodiments, oral cavity surface binding peptides and/or oral cavity surface binding domains may have a binding affinity, as measured by KD or MB50 values, of less than or equal to about 10-5 M, less than or equal to about 10-6 M, less than or equal to about 10-7 M, less than or equal to about 10-8 M, less than or equal to about 10-9 M or less or equal to about 10-10 M.
[118] As used in the present invention, the term "strong affinity" will refer to a binding affinity that has a KD or MB50 value less than or equal to about 10-5 M, preferably less than or equal to about 10- 6M, more preferably less than or equal to about 10-7M, more preferably less than or equal to about 10-8M, less than or equal to about 10-9M, or more preferably less than or equal to about 10-10 M. Enzyme powders
[119] In some embodiments, personal care compositions can use an enzyme catalyst in the form of a stabilized enzyme powder. Methods of making and stabilizing formulations comprising an enzyme powder are described in U.S. Patent Application Publication Nos. 2010-0086534 and 2010-0086535.
[120] In one embodiment, the enzyme may be in the form of enzyme powder in an amount and in a range from about 0.5 percent by weight (% by weight) to about 75 percent by weight, per example, from 1 percent by weight to about 60 percent by weight, based on the dry weight of the enzyme powder. A preferred weight percent range of the enzyme in the enzyme powder/atomized mix is about 10 wt% to 50 wt%, and a more preferred weight percent range of the enzyme in the enzyme powder/atomized mix is about from 20% by weight to 33% by weight.
[121] In one embodiment, the enzyme powder may further comprise an excipient. In one aspect, the excipient is provided in an amount ranging from about 95% by weight to about 25% by weight based on the dry weight of the enzyme powder. A preferred % by weight range of excipient in the enzyme powder is about 90% by weight and the preferred range in the enzyme powder is about 80% by weight to 67% by weight.
[122] In one embodiment, the excipient used to prepare an enzyme powder may be an oligosaccharide excipient. In one embodiment, the oligosaccharide excipient has a number average molecular weight of at least about 1250 and a weight average molecular weight of at least about 9000. In some embodiments, the oligosaccharide excipient has a number average molecular weight equal to at least about 9000. minus about 1700 and a weight average molecular weight of at least about 15000. Specific oligosaccharides may include, but are not limited to, maltodextrin, xylan, mannan, fucoidan, galactomannan, chitosan, raffinose, stachyose, pectin, insulin, levan , graminan, amylopectin, sucrose, lactulose, lactose, maltose, trehalose, cellobiose, nigerotriose, maltotriose, melezitose, maltotriulose, raffinose, ketosis and mixtures thereof. In a preferred embodiment, the oligosaccharide excipient is maltodextrin. Oligosaccharide-based excipients may also include, but are not limited to, water-soluble nonionic cellulose ethers such as hydroxymethylcellulose and hydroxypropylmethylcellulose, and mixtures thereof. In yet another embodiment, the excipient can be selected from, but not limited to, one or more of the following compounds: trehalose, lactose, sucrose, mannitol, sorbitol, glucose, cellobiose, α-cyclodextrin and carboxymethylcellulose. Suitable Acyl Ester/Donor Substrates
[123] Suitable carboxylic acid ester substrates may include esters having the following formula: (a) one or more esters having the structure [X]mR5 wherein: X is an ester group of the formula R6C(O)O; R6 is a linear, branched or cyclic C1 to C7 hydrocarbyl moiety, optionally substituted with a hydroxyl group or C1 to C4 alkoxy groups, wherein, optionally, R6 comprises one or more ether bonds where R6 is C2 to C7; R5 is a linear, branched or cyclic C1 to C6 hydrocarbyl moiety, or a five-membered cyclic heteroaromatic moiety or a six-membered cyclic aromatic or heteroaromatic moiety optionally substituted with a hydroxyl group; wherein each carbon atom in R5 individually comprises at most one hydroxyl group or at most one ester group or carboxylic acid group; and wherein R5 optionally comprises one or more ether bonds; m is an integer ranging from 1 to the number of carbon atoms in R5, said one or more esters having water solubility of at least 5 ppm at 25 °C; or (b) one or more glycerides with the structure
wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R3 and R4 are individually H or R1C(O); or (c) one or more formula esters
wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R2 is a C1 to C10 alkyl, alkenyl, alkynyl, aryl, alkylaryl, alkyl-heteroaryl or heteroaryl straight-chain or branched-chain, (CH2CH2O)n or (CH2CH(CH3)-O)nH, and n is from 1 to 10; or (d) one or more acetylated monosaccharides, acetylated disaccharides or acetylated polysaccharides; or (e) any combination of (a) through (d).
[124] Suitable substrates may also include one or more acylated saccharides selected from the group consisting of acylated mono, di and polysaccharides. In another embodiment, the acylated saccharides are selected from the group consisting of acetylated xylan; acetylated xylan fragments; acetylated xylose (such as xylose tetraacetate); acetylated glucose (such as α-D-glucose penta-acetate; β-D-glucose penta-acetate; 1-thio-P-D-glucose-2,3,4,6-tetra-acetate); β-D-galactose pentaacetate; sorbitol hexaacetate; sucrose octoacetate; β-D-ribofuranose-1,2,3,5-tetraacetate; P-D-ribofuranose-1,2,3,4-tetraacetate; tri-O-acetyl-D-galactal; tri-O-acetyl-D-glucal; β-D-xylofuranose tetraacetate, β-D-glycopyranose pentaacetate; β-D-glycopyranose-1,2,3,4-tetraacetate; β-D-glycopyranose-2,3,4,6-tetraacetate; 2-acetamido-2-deoxy-1,3,4,6-tetra-acetyl-D-glycopyranose; 2-acetamido-2-deoxy-3,4,6-triacetyl-1-chloride-α-D-glycopyranose; B-D-mannopyranose penta-acetate and acetylated cellulose. In a preferred embodiment, the acetylated saccharide is selected from the group consisting of β-D-ribofuranose-1,2,3,5-tetraacetate; tri-O-acetyl-D-galactal; tri-O-acetyl-D-glycal; sucrose octoacetate; and acetylated cellulose.
[125] In another embodiment, additional suitable substrates may also include 5-acetoxymethyl-2-furaldehyde; 3,4-diacetoxy-1-butene; 4-acetoxybenzoic acid; vanillin acetate; propylene glycol methyl ether acetate; methyl lactate; ethyl lactate; methyl glycolate; ethyl glycolate; methyl methoxyacetate; ethyl methoxyacetate; methyl 3-hydroxybutyrate; ethyl 3-hydroxybutyrate; and triethyl-2-acetyl citrate.
[126] In another embodiment, suitable substrates are selected from the group consisting of; monoacetin; diacetin; triacetin; monopropionine; dipropionine; trippropionine; monobutyrin; dibutyrin; tributyrin; glucose pentaacetate; xylose tetraacetate; acetylated xylan; acetylated xylan fragments; β-D-ribofuranose-1,2,3,5-tetraacetate; tri-O-acetyl-D-galactal; tri-O-acetyl-D-glycal; 1,2-ethanediol monoesters or diesters; 1,2-propanediol; 1,3-propanediol; 1,2-butanediol; 1,3-butanediol; 2,3-butanediol; 1,4-butanediol; 1,2-pentanediol; 2,5-pentanediol; 1,5-pentanediol; 1,6-pentanediol; 1,2-hexanediol; 2,5-hexanediol; 1,6-hexanediol; and mixtures thereof. In another embodiment, the substrate is a C1 to C6 polyol comprising one or more ester groups. In a preferred embodiment, one or more of the hydroxyl groups on the C1 to C6 polyol are replaced with one or more acetoxy groups (such as 1,3-propanediol diacetate; 1,2-propanediol diacetate; 1,4-butanediol diacetate; 1,5-pentanediol diacetate, etc.). In another embodiment, the substrate is propylene glycol diacetate (PGDA), ethylene glycol diacetate (EGDA) or a mixture thereof.
[127] In another embodiment, suitable substrates are selected from the group consisting of monoacetin, diacetin, triacetin, monopropionin, dipropionine, tripropionine, monobutyrin, dibutyrin, and tributyrin. In yet another aspect, the substrate is selected from the group consisting of diacetin and triacetin. In a more preferred embodiment, the suitable substrate comprises triacetin.
[128] The carboxylic acid ester is present in a concentration sufficient to produce the desired concentration of peroxycarboxylic acid upon enzyme-catalyzed perhydrolysis. The carboxylic acid ester need not be completely soluble in the reaction formulation, but it has sufficient solubility to allow conversion of the ester by the perhydrolase catalyst to the corresponding peroxycarboxylic acid. The carboxylic acid ester is present in the reaction formulation at a concentration of 0.05% by weight to 40% by weight of the reaction formulation, preferably at a concentration of 0.1% by weight to 20% by weight of the reaction formulation. reaction, and more preferably at a concentration of 0.5% by weight to 10% by weight of the reaction formulation.
[129] The peroxygen source is provided as granules deposited on or on the hydratable adhesive film and may include hydrogen peroxide adducts (eg, urea-hydrogen peroxide adduct (carbamide peroxide)) perborate salts, salts of percarbonate and peroxide salts. The concentration of the peroxygen compound in the reaction formulation may range from 0.0033% by weight to about 50% by weight, preferably from 0.033% by weight to about 40% by weight, more preferably from 0.1% by weight to about 30% by weight.
[130] Many perhydrolase catalysts (whole cells, permeabilized whole cells, and partially purified whole cell extracts) have been reported to exhibit catalase activity (EC 1.1 1.1.6). Catalases catalyze the conversion of hydrogen peroxide to oxygen and water. In one aspect, the perhydrolysis catalyst has no catalase activity. In another aspect, a catalase inhibitor can be added to the reaction formulation. A person skilled in the art can adjust the concentration of the catalase inhibitor as needed. The concentration of catalase inhibitor typically ranges from 0.1 mM to about 1 M; preferably, from about 1 mM to about 50 mM; more preferably from about 1 mM to about 20 mM.
[131] In another embodiment, the enzyme catalyst has no significant catalase activity or can be manipulated to decrease or eliminate catalase activity. Catalase activity in a host cell can be down-regulated or eliminated by disrupting the gene(s) responsible/responsible for catalase activity using well-known techniques, including, but not limited to, transposon mutagenesis, antisense RNA expression, targeted mutagenesis and random mutagenesis.
[132] The concentration of peroxycarboxylic acid generated (eg peracetic acid) by perhydrolysis of at least one carboxylic acid ester is equal to at least 0.1 ppm, preferably at least 0.5 ppm, 1 ppm, 5 ppm, 10ppm, 20ppm, 100ppm, 200ppm, 300ppm, 500ppm, 700ppm, 1000ppm, 2000ppm, 5000ppm or 10,000ppm of peracid within 10 minutes, preferably within 5 minutes after starting the perhydrolysis reaction. Obviously, a person skilled in the art can adjust the reaction components to achieve the desired concentration of peracid.
[133] In one aspect, the reaction time required to produce the desired concentration of peracid is no more than about two hours, preferably no more than about 30 minutes, more preferably no more than about 10 minutes, and more preferably, it is approximately 5 minutes or less. In other aspects, a surface of the oral cavity comes into contact with the peroxycarboxylic acid formed according to the processes described in the present invention within 5 minutes of hydration and combining the reaction components. In one embodiment, tooth enamel comes into contact with the peroxycarboxylic acid produced with the processes and compositions described herein within about 5 minutes to about 24 hours or within about 5 minutes to 2 hours of combination (via hydration by the user) of said reaction components present in or on the whitening strip/film. HPLC Assay Method for Determination of Peroxycarboxylic Acid and Hydrogen Peroxide Concentration
[134] A variety of analytical methods can be used to analyze reagents and products including, but not limited to, high performance liquid chromatography (HPLC), gas chromatography (GC), mass spectroscopy (MS), capillary electrophoresis (EC), the analytical procedure described by U. Pinkernell et al., (Anal. Chem., 69(17):3623-3627 (1997)), and the 2,2'-azino-bis-(3) assay. - ethylbenzotazoline)-6-sulfonate (ABTS) (U. Pinkernell et. al. Analyst, 122: 567-571 (1997) and Dinu et. al. Adv. Funct. Mater., 20: 392-398 (2010)) , as described in these examples. Exemplary Modalities:
[135] Modality 1. A tooth whitening strip (strip 1) comprising a hydratable adhesive film with a first side and a second side, the first side having a granular whitening ingredient attached thereto, wherein the strip comprises, in or on the film, or in granules attached to the first side of the film, (i) a protein with perhydrolytic activity that contains the signature portion of a member of the carbohydrate esterase family 7; (ii) an acyl donor, for example, selected from carboxylic acid esters and acyl compounds,
[136] Mode 2. Strip 1, wherein the protein having perhydrolase activity comprises an amino acid sequence selected from: a) MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDV TFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTR GQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQV DQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFL KTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNISPPSTVFAAYNYYAGPKEI RIYPYNNHEGGGSFQAVEQVKFLKKLFEKG (SEQ ID NO: 1), b) an amino acid sequence with i) an RGQ portion at positions corresponding to positions 118-120 of SEQ ID NO: 1; ii) a GXSQG portion at positions corresponding to positions 186-190 of SEQ ID NO: 1; and iii) an HE portion at positions corresponding to positions 303-304 of SEQ ID NO: 1; and c) an amino acid sequence that has at least 80% sequence identity with SEQ ID NO: 1.
[137] Modality 3. Modality 1 or 2, wherein the protein with perhydrolytic activity comprises an amino acid sequence that has affinity for, for example, binds to or complex with oral surfaces or, alternatively, has affinity for example, binds or complexes with one or more components of the whitening strip.
[138] Modality 4. Any of the above strips comprising a protein with perhydrolase activity that binds to or complexes with oral surfaces (eg tooth film or enamel) comprising an amino acid sequence selected from a ) MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDV TFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTR GQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYRRVFTDAVRAVEAAASFPQVD QERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLK THRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNISPPSTVFAAYNYYAGPKEIR IYPYNHEGGGSFQAVEQVKFLKKLFEKGGPGSGGAGSPGSAGGPGSTKPPRTPTANTSR PHHNFGSGGGGSPHHHHHH (SEQ ID NO: 2), b) an amino acid sequence having at least 80% sequence identity with SEQ ID NO: 2.
[139] Modality 5. Any of the above strips, in which the protein with perhydrolytic activity is delivered in granular form on the first surface of the film.
[140] Modality 6. Any of the above strips, the second side of the hydratable adhesive film being attached to a layer that inhibits the dissolution of the hydratable adhesive film.
[141] Modality 7. Any of the above strips, the granular bleaching ingredient being coated with a rapidly dissolving material such as corn starch, sodium sulfate, gum arabic and combinations thereof.
[142] Modality 8. Any of the above strips, with the granular bleaching ingredient selected from granules comprising organic and/or inorganic oxidants, for example, selected from hydrogen peroxide, urea peroxide, percarbonates, perborates, peroxymonophosphates, peroxydisulfates, peroxyacids and peracetic acid.
[143] Modality 9. Any of the above strips, where the granular bleaching ingredient is selected from solid peroxides and solid peroxide donors, for example, selected from peroxide salts or complexes (eg, such as as salts of peroxyphosphate, peroxycarbonate, perborate, peroxysilicate or persulfate; for example, calcium peroxyphosphate, sodium perborate, sodium carbonate peroxide, sodium peroxyphosphate and potassium persulfate); hypochlorites; urea peroxide; hydrogen peroxide polymer complexes such as hydrogen peroxide polymer-polyvinylpyrrolidone complexes; metal peroxides, for example zinc peroxide and calcium peroxide; peracids and combinations thereof.
[144] Modality 10. Any of the above strips, where the granular bleaching ingredient comprises urea peroxide, a polymeric hydrogen peroxide-polyvinylpyrrolidone complex, sodium percarbonate, or a combination of two or more thereof.
[145] Modality 11. Any of the above strips, wherein the particle size (D50) of the granules on the first surface of the film, eg granular bleaching ingredient, or perhydrolase or acyl donor in granular form is from 0.1 to 300 microns, eg 10 to 275 microns, eg 100 to 250 microns.
[146] Modality 12. Any of the above strips, wherein the granular bleaching ingredient comprises more than 0.01%, eg, from 0.01 to 0.1%, eg, from 0.02 to 0, 08% of the total weight of the hydratable adhesive film and a granular whitening ingredient attached thereto.
[147] Modality 13. Any of the above strips, the amount of granular whitening agent on the first side of the hydratable adhesive film is from 0.001 to 10 mg/cm2, for example, from 0.001 to 1 mg/cm2, per example, from 0.005 to 0.015 mg/cm2.
[148] Modality 14. Any of the above strips, where the acyl donor is selected from (i) one or more C2-18 carboxylic acid esters, eg, C2-6 carboxylic acid esters (eg, esters of acetyl), including linear or branched alkylcarboxylic acid esters, optionally substituted with hydroxy and/or C1-4 alkoxy; (ii) one or more acylated glycerides (eg mono, di and triglycerides), (iii) acylated saccharides and (iv) mixtures thereof.
[149] Modality 15. Any of the above strips, the acyl donor being selected from 1,2,3- triacetoxypropane (sometimes referred to herein as triacetin or glycerin triacetate) and acylated saccharides, e.g., acylated saccharides.
[150] Modality 16. Any of the above strips, comprising an acyl donor which comprises an ester compound having water solubility of at least 5 ppm at 25°C.
[151] Modality 17. Any of the above strips that comprise a peracid or that generate a peracid after use.
[152] Modality 18. Any of the above strips, with the ingredients present in sufficient amounts to provide, upon mixing, a whitening agent in an amount and concentration effective to whiten teeth.
[153] Modality 19. Any of the above strips, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from hydrophilic cellulose ethers (eg, carboxymethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose), polyvinyl acetates, carbomers (by eg CARBOPOL® 97 IP), polysaccharide gums (eg xanthan gum), modified food starches, modified gelatin (eg fish or animal based gelatin), crosslinked carboxyvinyl copolymers, crosslinked polyvinylpyrrolidones, polyethylene oxide (eg eg POLYOX™), polyacrylic acids and polyacrylates, polyvinyl alcohols, alginate, casein, pullulan and combinations thereof.
[154] Modality 20. Any of the above strips, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from hydrophilic cellulose ethers (eg, hydroxypropylmethylcellulose or hydroxypropylcellulose), polyethylene oxide, polyvinyl acetates, and carbomers (for example, CARBOPOL® 971 P); and combinations thereof.
[155] Modality 21. Any of the above strips, the hydratable adhesive film comprising hydroxypropylmethylcellulose, polyvinyl acetates and a carbomer, for example, in a dry weight ratio of 10-20 HPMC:2-10 PVAc:1 carbomer .
[156] Modality 22. Any of the above strips, the hydratable adhesive film further comprising a plasticizer, e.g., propylene glycol, polyethylene glycol or triacetin.
[157] Modality 23. Any of the above strips, with the first side of the hydratable adhesive film coated with a protective coating before use.
[158] Modality 24. Any of the above strips, where the hydratable adhesive film has a viscosity of at least 100,000 cps after activation, eg a viscosity of 100,000 to 200,000 cps.
[159] Modality 25. Any of the above strips, with the hydratable adhesive film being substantially dry prior to application.
[160] Modality 26. Any of the above strips, where the thickness of the hydratable adhesive film is 0.1 to 5 mm, eg 0.5 to 5 mm.
[161] Modality 27. Any of the above strips, the approximate total dimensions being 2 to 10 cm long x 0.5 to 2 cm wide x 0.1 to 10 mm thick, eg 1 to 10 mm thick, for example a strip where the surface area of one side is equal to 5 to 20 cm2, for example about 5 to 15 cm2, for example about 10 cm2.
[162] Modality 28. Any of the above strips, comprising beads coated with a hydrogen peroxide polymer-polyvinylpyrrolidone urea peroxide and/or sodium percarbonate complex, and perhydrolase beads on the first surface of the film, with triacetin dispersed in the film.
[163] Modality 29. Any of the above strips, further comprising granules of an anti-sensitivity agent, eg, potassium nitrate or arginine.
[164] Modality 30. A method (method 2) of whitening teeth which comprises applying the first side of a strip as described above, eg strip 1 et seq. directly to the teeth and leaving it for a sufficient time, eg at least 5 minutes, eg 10 to 60 minutes, eg 10 to 30 minutes, to whiten the teeth.
[165] Modality 31. A method (method 3) for making a strip for tooth whitening, eg a strip as described above, in accordance with strip 1 et seq., comprising providing a hydratable adhesive film, eg as described above, whose film has been removed from the water and not fully dried, or whose film has been moistened by adding granules of a granular bleaching ingredient to a film surface, for example, as described above, and drying the film with the added granules to a surface.
[166] For example, strips can be made by first making the hydratable adhesive film using conventional means and then adding the granular bleaching ingredient to a surface. The hydratable adhesive film strips can be removed from the water in a variety of ways known in the art, such as by extrusion or removal of an aqueous suspension (e.g., at a solids level of 10 to 30%) onto a heated mat, from which water is evaporated. Alternatively, the film is dried and then rewetted. The granules can be added to the surface of this film while the film is semi-dry, meaning just wet enough to be tacky, so that the granules adhere to the film surface. After the film is completely dry and cooled to room temperature, the granules continue to adhere to the film surface. Before use, therefore, the hydratable adhesive film and the strip as a whole are substantially dry. Because the peroxide is on the surface of the film, a relatively small amount of granules is needed to provide an effective concentration at the surface. Preferred modalities:
[167] When exposed to saliva or other water sources (such as tap water), the granules dissolve and release reaction components to enzymatically produce the desired peracid. Moisturizing the hydratable adhesive layer increases film adhesion, allowing the whitening film/strip to bond to the target surface (ie, tooth enamel).
[168] The hydratable adhesive film comprises one or more orally acceptable water-soluble polymers selected from hydrophilic cellulose ethers (eg, carboxymethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose), polyvinyl acetates, carbomers (eg, CARBOPOL® 97 IP), gums polysaccharides (eg xanthan gum), modified food starches, gelatin (eg fish or animal based gelatin), crosslinked carboxyvinyl copolymers, crosslinked polyvinylpyrrolidones, polyethylene oxide (eg POLYOX™), polyacrylic acids and polyacrylates , polyvinyl alcohols, alginate, casein, pullulan and combinations thereof. Adhesive gel formulations for use with tooth whitening agents are known in the art, for example, as described in U.S. Pat. 7,862,801; 5,746,598; 6,730,316; and 7,128,899; each incorporated by reference in its entirety. The adhesive film allows the peracid whitening agent to stay in contact with the teeth for extended periods of time and protect the soft tissue and thus it must provide a high viscosity, eg a viscosity after application of at least 100,000 centipoise (cps) (about 100 Pascal-seconds (Pas)), preferably 100,000 to 200,000 cps (100 to 200 Pa-s).
[169] Where a second film layer is used to protect the hydratable adhesive film from rapid degradation or dissolution, the carrier or backing material may be made of fabric, cloth, wood composite, resin, elastomer, paper, cellulose derivatives insoluble or less soluble such as ethylcellulose and cellulose acetate, polyvinyl chloride, wax, PARAFILM™, polyethylene, polyvinyl alcohol, TEFLON™, polyvinyl chloride, polyvinyl acetate and its derivatives.
[170] The granular bleaching ingredient can be a solid peroxide or solid peroxide donor selected from peroxide salts or complexes (such as peroxyphosphate, peroxycarbonate, perborate, peroxysilicate or persulfates salts; eg calcium peroxyphosphate, perborate sodium, sodium carbonate peroxide, sodium peroxyphosphate and potassium persulfate), hypochlorites; urea peroxide; hydrogen peroxide polymer complexes such as polyvinylpyrrolidone hydrogen peroxide polymer complexes and metal peroxides, for example, zinc peroxide and calcium peroxide; a solid peracid; and combinations thereof. In particular embodiments, the granular bleaching ingredient is urea peroxide or a hydrogen peroxide polymer-polyvinylpyrrolidone complex. The granular bleach ingredient can optionally be coated to provide improved storage stability (for example, coated with sodium sulfate, corn starch or gum arabic). List of preferred modalities:
[171] Preferred Mode 1. A tooth whitening strip comprising a hydratable adhesive film having a first side and a second side, the first side having a granular whitening ingredient attached thereto, the tooth whitening strip comprising further, in or on the film, or in the form of granules attached to the first side of the film; a) an enzyme with perhydrolytic activity, said enzyme having a signature portion of the carbohydrate esterase family 7 (CE-7) that aligns with a reference sequence SEQ ID NO: 1, said signature portion comprising: i) an RGQ motif portion at positions corresponding to positions 118-120 of SEQ ID NO: 1; ii) a GXSQG portion at positions corresponding to positions 186-190 of SEQ ID NO: 1; and iii) an HE portion at positions corresponding to positions 303-304 of SEQ ID NO: 1; and (b) at least one acyl donor substrate, said substrate being selected from the group consisting of: i) esters with the structure [X]mR5 where X = an ester group of formula R6C(O)O R6 = hydrocarbyl moiety linear, branched or cyclic C1 to C7, optionally substituted with hydroxyl groups or C1 to C4 alkoxy groups, which optionally comprises one or more ether bonds for R6 = C2 to C7; R5 = a linear, branched or cyclic C1 to C6 hydrocarbyl moiety, or a five-membered cyclic heteroaromatic moiety optionally substituted with hydroxyl groups; wherein each carbon atom in R5 individually comprises at most one hydroxyl group or at most one ester group or carboxylic acid group; wherein R5 optionally comprises one or more ether bonds; M is an integer ranging from 1 to the number of carbon atoms in R5; and wherein said esters have water solubility of at least 5 ppm at 25°C; ii) glycerides with the structure
VKs. wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R3 and R4 are individually H or R1C(O); iii) one or more formula esters
wherein R1 is a straight-chain or branched-chain C1 to C7 alkyl optionally substituted with a hydroxyl or a C1 to C4 alkoxy group, and R2 is a C1 to C10 alkyl, alkenyl, alkynyl, aryl, alkylaryl, alkyl-heteroaryl or heteroaryl straight-chain or branched-chain, (CH2CH2O)n or (CH2CH(CH3)-O)nH, and n is from 1 to 10; and iv) acetylated saccharides selected from the group consisting of acetylated monosaccharides, acetylated disaccharides and acetylated polysaccharide; wherein, upon hydration of the hydratable adhesive film, hydrogen peroxide is released from the granular bleaching ingredient and said enzyme catalyzes the formation of an effective amount of a peracid.
[172] Preferred modality 2. The tooth whitening strip, according to preferred modality 1, wherein the enzyme with perhydrolytic activity comprises an amino acid sequence selected from: a) SEQ ID NO: 1; and b) an amino acid sequence that has at least 80% sequence identity with SEQ ID NO: 1.
[173] Preferred modality 3. The tooth whitening strip, according to preferred modality 1, wherein the enzyme having perhydrolytic activity further comprises a binding domain fused to the N or C-terminus of the enzyme, said binding domain having affinity for an oral tissue or for the tooth whitening strip.
[174] Preferred embodiment 4. The tooth whitening strip, according to preferred embodiment 3, wherein the oral tissue affinity binding domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 178 to 197.
[175] Preferred modality 5. The tooth whitening strip, according to any of the preferred modality, the enzyme with perhydrolytic activity having an affinity for an oral tissue and comprising an amino acid sequence selected from a) SEQ ID NO: 2, and b) an amino acid sequence that has at least 80% sequence identity with SEQ ID NO: 2.
[176] Preferred embodiment 6. The tooth whitening strip, according to any of the preferred embodiments, further comprising a backing layer attached to said second side of the hydratable adhesive film, said backing layer being capable of inhibiting dissolution of hydratable adhesive film.
[177] Preferred Modality 7. The tooth whitening strip, according to any of the preferred embodiments, wherein the granular whitening ingredient is coated with a water-soluble coating capable of dissolving upon hydration.
[178] Preferred Modality 8. The tooth whitening strip, in accordance with any of the preferred embodiments above, wherein the granular whitening ingredient is selected from solid peroxides and solid peroxide donors.
[179] Preferred Mode 9. The tooth whitening strip, according to any of the preferred embodiments, with the granular whitening ingredient selected from peroxide salts, peroxide complexes, peroxyphosphate, peroxycarbonate, perborate, peroxysilicate, salts of persulfate, calcium peroxyphosphate, sodium perborate, sodium carbonate peroxide, sodium peroxyphosphate, potassium persulfate, hypochlorites, urea peroxide, hydrogen peroxide polymer complexes, hydrogen peroxide-polyvinylpyrrolidone polymer complexes, peroxides of metal, zinc peroxide, calcium peroxide and combinations thereof.
[180] Preferred Embodiment 10. The tooth whitening strip, in accordance with any of the above preferred embodiments, wherein the granular whitening ingredient comprises urea peroxide. In some embodiments, the granular bleach ingredient comprises a hydrogen peroxide polymer-polyvinylpyrrolidone complex. In some embodiments, the hydrogen peroxide polymer-polyvinylpyrrolidone complex is a polyvinylpyrrolidone polymer complex crosslinked with hydrogen peroxide.
[181] Preferred Modality 11. The tooth whitening strip, according to any of the preferred embodiments, with the average particle diameter (D50) of the granular whitening ingredient ranging from 10 microns to 300 microns, for example, 10 microns to 200 microns.
[182] Preferred Embodiment 12. The tooth whitening strip according to any one of the preferred embodiments, wherein the tooth whitening strip comprises from about 0.01% by weight to about 0.1% by weight of a peracid. In some embodiments, the granular bleach ingredient comprises from about 0.1% by weight to about 30% by weight of a peroxygen source.
[183] Preferred Modality 13. The tooth whitening strip, according to any of the preferred embodiments above, with the amount of granular whitening agent on the first side of the hydratable adhesive film ranging from 0.001 mg/cm2 to 10 mg/ cm2, for example, from 0.001 mg/cm2 to 1 mg/cm2.
[184] Preferred Modality 14. The tooth whitening strip, according to any of the preferred embodiments above, the acyl donor substrate being 1,2,3-triacetoxypropane.
[185] Preferred Modality 15. The tooth whitening strip, according to any of the preferred embodiments, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, carboxymethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose , a polyvinyl acetate, a carbomer, a polysaccharide gum, xanthan gum, a modified food starch, gelatin, fish or animal based gelatin, a cross-linked carboxyvinyl copolymer, a cross-linked polyvinylpyrrolidone, polyethylene oxide, a polyacrylic acid, a polyacrylate, a polyvinyl alcohol, alginate, casein, pullulan and a combination of two or more thereof.
[186] Preferred Modality 16. The tooth whitening strip, according to any of the preferred embodiments above, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, a polyvinyl acetate , a carbomer and a combination of two or more of them.
[187] Preferred Modality 17. The tooth whitening strip, in accordance with any of the preferred embodiments above, wherein the hydratable adhesive film comprises hydroxypropylmethylcellulose (HPMC), polyvinyl acetate (PVAc) and a carbomer in a weight ratio Dry for HMPC:PVAc:carbomer from 10 to 20:2 to 10:1.
[188] Preferred Modality 18. The tooth whitening strip, in accordance with any of the preferred embodiments above, the hydratable adhesive film further comprising a plasticizer.
[189] Preferred Embodiment 19. The tooth whitening strip, in accordance with any of the above preferred embodiments, further comprising propylene glycol.
[190] Preferred Mode 20. A method of whitening teeth comprising a) providing a packaging system comprising the tooth whitening strip, in accordance with any of the above preferred embodiments; b) remove the tooth whitening strip from the packaging system; and placing the tooth whitening strip directly in contact with the teeth for a period of time sufficient to whiten the teeth; wherein the tooth whitening strip is hydrated by moisture present in the oral cavity or tooth surface or is hydrated after step (b) but before step (c).
[191] Preferred Mode 21. Method of Preferred Mode 20, wherein the whitening strip further comprises a backing layer attached to said second side of the hydratable adhesive film, said backing layer being capable of inhibiting the dissolution of the hydratable adhesive film .
[192] Preferred Modality 22. Method according to any of the preferred embodiments above, wherein the average particle diameter (D50) of the granular bleaching ingredient ranged from 10 microns to 200 microns.
[193] Preferred Embodiment 23. A method according to any of the above preferred embodiments, wherein the granular bleaching ingredient comprises greater than 0.01% by weight of the total weight of the hydratable adhesive film, and a bound granular bleaching ingredient at the same. In some embodiments, the granular bleaching ingredient comprises greater than 0.05% by weight of the total weight of the hydratable adhesive film and a granular bleaching ingredient attached thereto. In some embodiments, the granular bleaching ingredient comprises from about 0.01% by weight to about 0.1% by weight of the total weight of the hydratable adhesive film and a granular bleaching ingredient attached thereto.
[194] Preferred embodiment 24. The method, according to any of the preferred embodiments above, wherein the amount of granular whitening agent on the first side of the hydratable adhesive film ranges from 0.001 mg/cm2 to 1 mg/cm2.
[195] Preferred Embodiment 25. A method according to any of the above preferred embodiments, wherein the acyl donor substrate is 1,2,3-triacetoxypropane.
[196] Preferred Modality 26. Method according to any of the preferred embodiments above, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, carboxymethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, an acetate of polyvinyl, a carbomer, a polysaccharide gum, xanthan gum, a modified food starch, gelatin, fish or animal gelatin, a cross-linked carboxyvinyl copolymer, a cross-linked polyvinylpyrrolidone, polyethylene oxide, a polyacrylic acid, a polyacrylate, an alcohol polyvinyl, alginate, casein, pullulan and a combination of two or more of them.
[197] Preferred Modality 27. Method according to any of the preferred embodiments above, wherein the hydratable adhesive film comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, a polyvinyl acetate, a carbomer and a combination of two or more of them.
[198] Preferred Modality 28. Method according to any of the preferred embodiments above, wherein the hydratable adhesive film comprises hydroxypropylmethylcellulose (HPMC), polyvinyl acetate (PVAc) and a carbomer in a dry weight ratio for HMPC:PVAc :carbomer from 10 to 20 : 2 to 10 : 1.
[199] Preferred embodiment 29. Method according to any of the above preferred embodiments, wherein the hydratable adhesive film further comprises a plasticizer.
[200] Preferred embodiment 30. Method according to any of the above preferred embodiments, wherein the hydratable adhesive film further comprises propylene glycol.
[201] Preferred Embodiment 31. A method according to any of the preferred embodiments, wherein the granular bleaching ingredient is coated with a water-soluble coating capable of dissolving upon hydration.
[202] Preferred Mode 32. A method for making a tooth whitening strip, comprising: a) providing a semi-dry hydratable adhesive film, b) applying granules of a granular whitening ingredient to a film surface, whereby the granules adhere to the surface, and c) drying the film.
[203] In some embodiments, the average particle diameter (D50) of the granular bleaching ingredient ranges from 10 microns to 300 microns. In some embodiments, the average particle diameter (D50) of the granular bleaching ingredient ranges from 25 microns to 200 microns. In some embodiments, the average particle diameter (D50) of the granular bleaching ingredient ranges from 35 microns to 150 microns. In some embodiments, the average particle diameter (D50) of the granular bleaching ingredient ranges from 50 microns to 125 microns. In some embodiments, the average particle diameter (D50) of the granular bleaching ingredient ranges from 60 microns to 100 microns. In some embodiments, the average particle diameter (D64) of the granular bleaching ingredient is about 64 microns. In some embodiments, the average particle diameter (D94) of the granular bleaching ingredient is about 64 microns.
[204] In some embodiments, the mean particle diameter (D50) of the enzyme that has perhydrolytic activity is 100 microns to 300 microns. In some embodiments, the mean particle diameter (D50) of the enzyme that has perhydrolytic activity is 150 microns to 275 microns. In some embodiments, the mean particle diameter (D50) of the enzyme having perhydrolytic activity is 175 microns to 250 microns.
[205] All ingredients for use in the strips described in the present invention must be orally acceptable. By "orally acceptable", as the term is used in the present invention, is meant an ingredient that is present in a strip as described in an amount and in a manner that does not make the strip unsafe for use in the oral cavity.
[206] As used throughout the document, ranges are used as an abbreviation to describe each value that falls within the range. Any value within the range can be selected as the end of the range. In addition, all references cited in this document are hereby incorporated by reference in their entirety. To the extent that a definition of the present disclosure and a cited reference conflict, the present disclosure prevails.
[207] Unless otherwise specified, all percentages and quantities expressed in this document and elsewhere in the specification are to be understood as referring to percentages by weight. The quantities given are based on the active weight of the material. EXAMPLES
[208] The following examples are provided to demonstrate preferred aspects of the invention. It should be understood by those skilled in the art that the techniques disclosed in the examples below are techniques to function well in the practice of the invention and, therefore, can be considered to constitute preferred modes for its practice. However, persons skilled in the art should, in light of this disclosure, note that many changes can be made to the specific modalities that are disclosed and still achieve an equal or similar result without departing from the spirit and scope of the methods and examples presently disclosed.
[209] All reagents and materials were obtained from DIFCO Laboratories (Detroit, MI), GIBCO/BRL (Gaithersburg, MD), TCI America (Portland, OR), Roche Diagnostics Corporation (Indianapolis, IN), Thermo Scientific (Pierce Protein Research Products) (Rockford, IL) or Sigma/Aldrich Chemical Company (St. Louis, MO), unless otherwise specified.
[210] The following abbreviations in the descriptive report correspond to measurement units, techniques, properties or compounds as follows: "sec" or "s" means second(s), "min" means minute(s), "h" or "hr" means hour(s), "μL" means microliter(s), "mL" means milliliter(s), "L" means liter(s), "mM" means millimolar, "M" means molar, " mmol" means millimol(s), "ppm" means part(s) per million, "wt" means weight, "wt %" means percent by weight, "g" means gram(s), "mg" means milligram(s ), "g" means microgram(s) and "ng" means nanogram(s). Example 1
[211] A strip is prepared as described above, forming the hydratable adhesive film and then, while the film is tacky, adding the granulated bleaching agent and granulated enzyme to the surface on one side, using the ingredients in table 1. The strip will slowly erode in the mouth after application and therefore does not need to be removed.

[212] The strip in example 1 is removed from the water by extrusion or casting an aqueous suspension (eg 10 to 30% solids content) onto a heated mat, from which the water is evaporated. Granules are added to the surface of this film when it is semi-dry or dry but still sticky. Once cooled to room temperature, the granules adhere to the film surface. For a strip with an area of 10 cm2 and a weight of 10 mg/cm2, this formula provides 5 mg of triacetin. Assuming that 1.4 mg of the whitening granules are dispensed onto the strip, along with 0.3 mg of enzyme granules, this dose is sufficient for enough peracetic acid directly on the tooth surface to make a whitening strip with just peroxide work significantly better. (Peroxide-only strips typically have a total dose of about 3 to 10 mg of peroxide).
[213] When exposed to saliva or other sources of water (such as tap water), the granules immediately dissolve and become active. The adhesive layer is also activated and adheres to the teeth effectively. Example 1 is designed to slowly erode in the mouth over time so the user does not need to remove it. Example 2
[214] A strip is prepared as described above, forming the hydratable adhesive film and then, while the film is still tacky, adding the granulating agents to one side and the protective backing layer to the other side, using the ingredients in the table 2. Since the backing layer will not dissolve, the user should remove it after a sufficient period of time has passed to allow bleaching to occur, usually about 10 to 30 minutes. The two layers can also be produced simultaneously by extrusion or solvent-based casting, then granular bleaching agent can be added to the surface of the hydratable adhesive film. Table 2
Example 3
[215] Various particle sizes of the hydrogen peroxide-polyvinylpyrrolidone complex and an enzyme with perhydrolytic activity ("enzyme") were evaluated for their ability to generate peracetic acid uniformly across the surface of a hydratable adhesive strip containing triacetin.
[216] To assess the generation of peracetic acid from this product, 0.3175 cm (3/8") discs were cut from the film. Each disc was hydrated with 20 µl of 50 mM sodium phosphate buffer, pH 7.2 and incubated at 37°C for 15 min. 380 of 0.1 M phosphoric acid was added to the film to suppress the enzymatic reaction and dilute the sample for detection. The solution was analyzed for peracetic acid with HPLC analysis for peracetic acid using the method described above in U.S. Patent No. 7,829,315, to DiCosimo et al.. For each evaluation, a minimum of three samples were cut from the strip product to a length of 60.96 cm (24 inches) of film. .
[217] Strip samples with the enzyme and a hydrogen peroxide-polyvinylpyrrolidone coating were made by first incorporating the enzyme into a polymeric pullulan film. The dry film containing the enzyme was ground and sieved to a particle size of 60 to 80 mesh (177 µm to 250 µm). The particulate form of the enzyme was then mixed with hydrogen peroxide-polyvinylpyrrolidone (PEROXYDONE™ XL-10, Ashland Inc., Wilmington, DE). This mixture was deposited onto a two-layer film structure with a hydratable adhesive layer containing primarily polyethylene oxide and triacetin, and a polyvinyl alcohol backing layer to provide a non-dissolving backing layer. The results of the evaluation of peracetic acid generation for two consecutive analyzes are listed in table 3. The samples were evaluated at the beginning and at the end of production and demonstrate an unsatisfactory consistency for peracetic acid. Table 3: Peracetic acid production from hydratable adhesive strips produced with a perhydrolase enzyme coating on pullulan and PEROXYDONE™ XL-10.

[218] PEROXYDONE XL-10 was subsequently processed to form larger particles by granulation with high shear ethanol. After granulation, the sample was sieved to a particle size of 60 to 200 mesh (75 µm to 250 µm). The particle size distribution of PEROXYDONE™ XL-10, as used to produce samples described in table 3, and PEROXYDONE™ XL-10 after high shear granulation and sieving, are described in table 4. Samples were measured in a Beckman Coulter LSI 3320 equipped with a Tornado dry feeder. The powders were analyzed directly without being dispersed in a liquid. Table 4: Particle size distribution for PEROXYDONE XL-10 used in deposition before and after granulation.

[219] Another strip production analysis was performed by first preparing an enzyme sample loaded into the pullulan matrix at twice the concentration of the samples in Table 3. The pullulan film was ground and sieved to 60 to 80 mesh (177 μm to 250 µm) and then combined with PEROXYDONE XL-10 granules. The blend was then coated onto a two-layer film structure as described above. The evaluation of this sample for the generation of peracetic acid is given in Table 4 and demonstrated a higher and more consistent production throughout the production analysis. Table 5: Production of Peracetic Acid from Moisturizing Adhesive Strips with a Perhydrolase Enzyme Coating in Pullulan and PEROXYDONE™ XL-10 Granulated under High Shear.

权利要求:
Claims (18)
[0001]
1. Tooth whitening strip CHARACTERIZED by comprising a hydratable adhesive film with a first side and a second side, the first side having a granular whitening ingredient attached thereto, wherein the strip comprises, in or on the film, or in form of granules attached to the first side of the film, (i) a granular protein having perhydrolase activity that contains the catalytic domain of a member of the carbohydrate esterase family 7; and (ii) a carboxy donor, wherein after use, the peroxide released by the granular bleach ingredient reacts with the carboxy donor in the presence of the perhydrolase to form a peracid; wherein the granulated protein with perhydrolase activity comprises an amino acid sequence selected from SEQ ID NO: 1; wherein the tooth whitening strip comprises a backing layer; wherein the carboxy donor is 1,2,3-triacetoxypropane; wherein the hydratable adhesive film comprises hydroxypropylmethylcellulose (HPMC); and where the granules dissolve immediately and become active when exposed to saliva or other sources of water.
[0002]
2. Tooth whitening strip, according to claim 1, CHARACTERIZED by the fact that the protein with perhydrolase activity has affinity for oral tissue and further comprises an amino acid sequence selected from a) ) SEQ ID NO: 2 MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVE AYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFV MDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYRRVFTDAVRAVEAAASF PQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEIT NFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNISPPSTVFAAYNYYAGP KEIRIYPYNHEGGGSFQAVEQVKFLKKLFEKGGPGSGGAGSPGSAGGPGSTKPPRTPTA NTSRPHHNFGSGGGGSPHHHHHH, b) an amino acid sequence having at least 80% sequence identity to SEQ ID NO: 2.
[0003]
3. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the granular whitening ingredient is coated with a rapidly dissolving material.
[0004]
4. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the granular whitening ingredient is selected from solid peroxides and solid peroxide donors.
[0005]
5. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the granular whitening ingredient is selected from salts or complexes of peroxide, peroxyphosphate, peroxycarbonate, perborate, peroxysilicate, persulfate salts, calcium peroxyphosphate, sodium perborate, sodium carbonate peroxide, sodium peroxyphosphate, potassium persulfate, hypochlorites, urea peroxide, hydrogen peroxide polymer complexes, hydrogen peroxide polymer-polyvinylpyrrolidone complexes, metal peroxides, zinc peroxide, calcium peroxide and combinations thereof.
[0006]
6. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the granular whitening ingredient comprises urea peroxide.
[0007]
7. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the particle size (D50) of the granular whitening ingredient is 10-200 microns.
[0008]
8. Tooth whitening strip according to claim 7, CHARACTERIZED by the fact that the granular whitening ingredient comprises 0.1% or less of the total weight of the hydratable adhesive film and a granular whitening ingredient attached thereto.
[0009]
9. Tooth whitening strip according to claim 8, CHARACTERIZED by the fact that the amount of granular whitening agent on the first side of the hydratable adhesive film is 0.001-1 mg/cm2.
[0010]
A tooth whitening strip, according to claim 1, characterized in that it comprises a peracid or that it generates a peracid when used.
[0011]
11. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the ingredients are present in sufficient amounts to provide, after mixing, a whitening agent in an amount and concentration effective to whiten teeth.
[0012]
12. Tooth whitening strip, according to claim 1, CHARACTERIZED by the fact that the hydratable adhesive film further comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, carboxymethylcellulose, hydroxypropylcellulose, a polyvinyl acetate, a carbomer, a polysaccharide gum, xanthan gum, a modified food starch, gelatin, fish or animal based gelatin, a cross-linked carboxyvinyl copolymer, a cross-linked polyvinylpyrrolidone, polyethylene oxide, a polyacrylic acid, a polyacrylate, a polyvinyl alcohol, alginate, casein, pullulan and a combination of two or more of them.
[0013]
13. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the hydratable adhesive film comprises one or more water-soluble polymers selected from a hydrophilic cellulose ether, a polyvinyl alcohol, a carbomer and a combination of two or more of them.
[0014]
14. Tooth whitening strip, according to claim 1, CHARACTERIZED by the fact that the hydratable adhesive film further comprises a plasticizer.
[0015]
15. Tooth whitening strip, according to claim 1, CHARACTERIZED by the fact that the hydratable adhesive film further comprises a propylene glycol.
[0016]
16. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that the granular whitening ingredient is coated with a water-soluble coating capable of dissolving after hydration.
[0017]
17. Tooth whitening strip according to claim 1, CHARACTERIZED by the fact that an effective amount of a peracid is generated in a substantially uniform concentration over the entire surface of the tooth whitening strip.
[0018]
A method of whitening teeth CHARACTERIZED by comprising a) providing a packaging system comprising the tooth whitening strip as defined in claim 1; b) remove the tooth whitening strip from the packaging system; and c) placing the tooth whitening strip directly in contact with the teeth for a period of time sufficient to whiten the teeth; wherein the tooth whitening strip is hydrated by moisture present in the oral cavity or tooth surface or is hydrated after step (b) but before step (c).

类似技术:

---

公开号 | 公开日 | 专利标题

---

BR112014014771B1|2021-05-25|tooth whitening strip and teeth whitening method using said strip

---

JP6235482B2|2017-11-22|System that provides perhydrolase-catalyzed reaction

---

RU2745517C2|2021-03-25|Oral cavity care compositions and methods for increasing their stability

---

TW201424767A|2014-07-01|System providing perhydrolase-catalyzed reaction

---

TW201424754A|2014-07-01|Peracid-generating compositions

---

TW201705932A|2017-02-16|Peracid-generating compositions

---

TW201521780A|2015-06-16|System providing perhydrolase-catalyzed reaction

同族专利:

---

公开号 | 公开日

---

MX349685B|2017-08-09|

---

PH12014501382A1|2014-10-08|

---

TWI538692B|2016-06-21|

---

US20140314829A1|2014-10-23|

---

TWI587872B|2017-06-21|

---

CO6980625A2|2014-06-27|

---

RU2014129476A|2016-02-10|

---

HK1203403A1|2015-10-30|

---

TW201639542A|2016-11-16|

---

WO2013096321A9|2013-08-29|

---

CN104244918B|2017-11-21|

---

CN104244918A|2014-12-24|

---

CA2859569C|2020-05-26|

---

JP6181666B2|2017-08-16|

---

MX2014007337A|2014-11-25|

---

EP2793822A2|2014-10-29|

---

AU2012355355B2|2015-04-16|

---

JP2015502369A|2015-01-22|

---

EP2793822B1|2016-08-24|

---

TW201330861A|2013-08-01|

---

BR112014014771A2|2020-10-27|

---

AU2012355355A1|2014-07-03|

---

CA2859569A1|2013-06-27|

---

SG11201403232SA|2014-07-30|

---

AR089341A1|2014-08-13|

---

US9884000B2|2018-02-06|

---

RU2581906C2|2016-04-20|

---

WO2013096321A2|2013-06-27|

---

ZA201404448B|2016-03-30|

---

PL2793822T3|2017-11-30|

---

WO2013096321A3|2014-03-27|

---

ES2605158T3|2017-03-13|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

---

US5376006A|1990-03-22|1994-12-27|Ultradent Products, Inc.|Dental bleaching compositions and methods for bleaching teeth surfaces|

---

AT154754T|1991-04-08|1997-07-15|Isp Investments Inc|METHOD FOR PRODUCING PVP-H202 PRODUCTS|

---

US5279618A|1991-09-26|1994-01-18|Clairol Incorporated|Process and kit for dyeing hair|

---

US5279816A|1991-11-22|1994-01-18|Colgate-Palmolive Co.|Oral composition having improved tooth whitening effect|

---

US5302375A|1992-11-19|1994-04-12|Colgate-Palmolive Company|Oral composition having improved tooth whitening effect|

---

US5403549A|1993-11-04|1995-04-04|Cyclo3 pss Medical Systems, Inc.|Method for sterilization using a fluid chemical biocide|

---

CN1315455C|1995-08-18|2007-05-16|诺沃奇梅兹有限公司|Tooth bleaching|

---

US5879691A|1997-06-06|1999-03-09|The Procter & Gamble Company|Delivery system for a tooth whitener using a strip of material having low flexural stiffness|

---

US5894017A|1997-06-06|1999-04-13|The Procter & Gamble Company|Delivery system for an oral care substance using a strip of material having low flexural stiffness|

---

US6136297A|1997-06-06|2000-10-24|The Procter & Gamble Company|Delivery system for an oral care substance using a strip of material having low flexural stiffness|

---

US6096328A|1997-06-06|2000-08-01|The Procter & Gamble Company|Delivery system for an oral care substance using a strip of material having low flexural stiffness|

---

US6221341B1|1997-11-19|2001-04-24|Oraceutical Llc|Tooth whitening compositions|

---

US6274122B1|1999-01-07|2001-08-14|Mclaughlin Gerald|Device and method using dry mixtures for whitening teeth|

---

AU4985299A|1999-07-12|2001-01-30|Procter & Gamble Company, The|Polyhydroxyl/phosphate copolymers and compositions containing the same|

---

WO2001064175A1|2000-03-01|2001-09-07|Lucas Huybrechts|Tooth whitening products and procedures|

---

US7785572B2|2000-03-17|2010-08-31|Lg Household And Health Care Ltd.|Method and device for teeth whitening using a dry type adhesive|

---

AT421894T|2000-03-17|2009-02-15|Lg Household & Health Care Ltd|PUNCH TO KNOW THE TEETH|

---

US6689344B2|2000-03-17|2004-02-10|Lg Household & Healthcare Ltd.|Patches for teeth whitening|

---

JP2004525823A|2000-12-23|2004-08-26|アカンティア・ホールディングス・リミテッド|Packaging system|

---

US6500408B2|2001-01-27|2002-12-31|Jc Technologies, Inc.|Enamel-safe tooth bleach and method for use|

---

US6503486B2|2001-03-12|2003-01-07|Colgate Palmolive Company|Strip for whitening tooth surfaces|

---

US6419906B1|2001-03-12|2002-07-16|Colgate Palmolive Company|Strip for whitening tooth surfaces|

---

US6514484B2|2001-03-19|2003-02-04|The Procter & Gamble Company|Systems for delivering a cosmetic and/or therapeutic active to oral surfaces using an integral carrier|

---

US6503485B1|2001-08-06|2003-01-07|Ultradent Products, Inc.|Two-part dental bleaching systems having improved gel stability and methods for bleaching teeth using such systems|

---

US20050260544A1|2001-08-17|2005-11-24|Stephen Jones|Novel device|

---

DE20114352U1|2001-08-30|2003-01-16|Klocke Verpackungs Service|Air fresheners|

---

US6732887B2|2002-03-26|2004-05-11|Ultradent Products, Inc.|Two-part composition syringe delivery system|

---

WO2003082744A1|2002-03-28|2003-10-09|Council Of Scientific And Industrial Research|Process for the preparation of lithium hexafluoroarsenate|

---

US6949240B2|2002-05-23|2005-09-27|The Procter & Gamble Company|Tooth whitening products|

---

FR2842541B1|2002-07-18|2004-10-01|Eastman Kodak Co|MATERIAL FOR INKJET PRINTING IMAGE FORMATION|

---

US20040018156A1|2002-07-23|2004-01-29|Szeles Lori H|Enzyme enhanced breath freshening film|

---

US20050100515A1|2002-09-11|2005-05-12|The Procter & Gamble Company|Tooth whitening products|

---

US20040120903A1|2002-09-11|2004-06-24|The Procter & Gamble Company|Tooth whitening strips|

---

US20050019277A1|2002-09-11|2005-01-27|The Procter & Gamble Company|Tooth whitening products|

---

US20040062723A1|2002-09-27|2004-04-01|Zaidel Lynette A.|Dual component tooth whitening dentifrice|

---

US6893629B2|2002-10-30|2005-05-17|Isp Investments Inc.|Delivery system for a tooth whitener|

---

DE10260903A1|2002-12-20|2004-07-08|Henkel Kgaa|New perhydrolases|

---

US6669929B1|2002-12-30|2003-12-30|Colgate Palmolive Company|Dentifrice containing functional film flakes|

---

JP4359457B2|2003-07-31|2009-11-04|株式会社小森コーポレーション|Roller moving device|

---

US20050069502A1|2003-08-15|2005-03-31|Chopra Suman K.|Hydrophobic polymer carrier based liquid tooth whitening composition|

---

US8815215B2|2003-08-15|2014-08-26|Colgate-Palmolive Company|Hydrophobic tooth whitening system and methods of use|

---

US20050038181A1|2003-08-15|2005-02-17|Colgate-Palmolive Company|Silicone polymer based liquid tooth whitening composition|

---

US7807141B2|2003-09-08|2010-10-05|E.I. Du Pont De Nemours And Company|Peptide-based oral care surface reagents for personal care|

---

US7243788B2|2003-10-22|2007-07-17|Kimberly-Clark Worldwide, Inc.|Package for segregating and mixing substances|

---

US7754460B2|2003-12-03|2010-07-13|Danisco Us Inc.|Enzyme for the production of long chain peracid|

---

DE602004031662D1|2003-12-03|2011-04-14|Procter & Gamble|perhydrolase|

---

DE60329036D1|2003-12-15|2009-10-08|Council Scient Ind Res|ECOLOGICAL PROCESS FOR THE PREPARATION OF BROMBENZOL|

---

AU2005231416A1|2004-04-01|2005-10-20|Smithkline Beecham Corporation|Dissolvable tooth whitening strip|

---

US7118732B2|2004-05-10|2006-10-10|Colgate-Palmolive Company|Tooth-whitening compositions comprising silicone polymer and methods therefor|

---

US20050249678A1|2004-05-10|2005-11-10|Mahmoud Hassan|Multilayer tooth whitening strips|

---

US20050281757A1|2004-06-17|2005-12-22|Sayed Ibrahim|Oral care film|

---

DE102004029475A1|2004-06-18|2006-01-26|Henkel Kgaa|New enzymatic bleaching system|

---

US20060024246A1|2004-07-29|2006-02-02|Prithwiraj Maitra|Oral care compositions with film forming polymers|

---

CA2822643A1|2004-12-21|2006-06-29|Corium International, Inc.|Sustained release tooth whitening formulations and systems|

---

ITMO20050057A1|2005-03-15|2006-09-16|Lameplast Spa|PACKAGE FOR PRODUCTS WITH ESTEMPORANEA PREPARATION, PARTICULARLY MEDICINAL, PHARMACEUTICAL, COSMETIC OR SIMILAR.|

---

WO2006119060A1|2005-04-29|2006-11-09|E. I. Du Pont De Nemours And Company|Enzymatic production of peracids using perhydrolytic enzymes|

---

US20060292092A1|2005-06-22|2006-12-28|Deepak Sharma|Oral care compositions, devices, and methods of using the same|

---

US8414293B2|2005-06-28|2013-04-09|Colgate-Palmolive Company|Carrier strip for application to oral surfaces and related methods|

---

US7794378B2|2005-08-10|2010-09-14|Guthy-Renker Llc|Exercise chair with side supporters|

---

DE202005015085U1|2005-09-28|2005-12-01|Klocke Verpackungs-Service Gmbh|Packing has rigid insert between second film and applicator extending beyond intended break point opposite it by such degree that with breaking open of packing the medium applicator is extracted from chamber|

---

KR20080059411A|2005-09-29|2008-06-27|알콘, 인코퍼레이티드|Dual-chamber solution packaging system|

---

US7951566B2|2005-12-13|2011-05-31|E.I. Du Pont De Nemours And Company|Production of peracids using an enzyme having perhydrolysis activity|

---

US8518675B2|2005-12-13|2013-08-27|E. I. Du Pont De Nemours And Company|Production of peracids using an enzyme having perhydrolysis activity|

---

US7964378B2|2005-12-13|2011-06-21|E.I. Du Pont De Nemours And Company|Production of peracids using an enzyme having perhydrolysis activity|

---

US7723083B2|2005-12-13|2010-05-25|E.I. Du Pont De Nemours And Company|Production of peracids using an enzyme having perhydrolysis activity|

---

RU2008139320A|2006-03-03|2010-04-10|Джененкор Интернэшнл, Инк. |PERHYDROLASE FOR TEETH WHITENING|

---

US20070231277A1|2006-03-31|2007-10-04|Deepak Sharma|Multicomponent whitening compositions and containers|

---

SG170829A1|2006-04-04|2011-05-30|Basf Se|Bleach systems enveloped with polymeric layers|

---

US7909165B2|2006-04-10|2011-03-22|Poppack, Llc|System for delivering sequential components|

---

US7776010B2|2006-05-01|2010-08-17|Ultradent Products, Inc.|Syringe-in-syringe hollow inner barrel/plunger with integral seal and rupturable membrane and related kits, systems, and methods|

---

US20080260836A1|2007-04-18|2008-10-23|Thomas James Boyd|Films Comprising a Plurality of Polymers|

---

EP2155867B1|2007-05-10|2015-10-14|Danisco US Inc.|Stable enzymatic peracid generating systems|

---

DE102007036392A1|2007-07-31|2009-02-05|Henkel Ag & Co. Kgaa|Compositions containing perhydrolases and alkylene glycol diacetates|

---

CN102239257A|2008-10-03|2011-11-09|纳幕尔杜邦公司|Stabilization of perhydrolases with excipients|

---

WO2010114638A1|2009-03-30|2010-10-07|E. I. Du Pont De Nemours And Company|Peptide-based tooth whitening reagents|

---

US8222012B2|2009-10-01|2012-07-17|E. I. Du Pont De Nemours And Company|Perhydrolase for enzymatic peracid production|

---

WO2011090980A1|2010-01-20|2011-07-28|Danisco Us Inc.|Mold treatment|

---

TWI435733B|2010-01-29|2014-05-01|Colgate Palmolive Co|Oral care formulations for malodor control|

---

US8206964B2|2010-03-26|2012-06-26|E. I. Du Pont De Nemours And Company|Perhydrolase providing improved specific activity|

---

US8389254B2|2010-03-26|2013-03-05|E.I. Du Pont De Nemours And Company|Perhydrolase providing improved specific activity|

---

EP2654695B8|2010-12-20|2020-03-04|DuPont US Holding, LLC|Enzymatic peracid generation for use in oral care products|

---

AU2012245338A1|2011-04-21|2013-10-24|Intercontinental Great Brands Llc|Improved stability of peroxide in oral care compositions|

---

AU2011376960B2|2011-09-14|2015-10-29|Colgate-Palmolive Company|Tooth whitening strip|

---

SG11201402541TA|2011-12-19|2014-08-28|Colgate Palmolive Co|System providing enzyme-catalyzed reaction|

---

CA2859793C|2011-12-19|2019-10-01|Colgate-Palmolive Company|Oral care system providing perhydrolase-catalyzed peracid formation|

---

JP6181666B2|2011-12-19|2017-08-16|コルゲート・パーモリブ・カンパニーＣｏｌｇａｔｅ−Ｐａｌｍｏｌｉｖｅ Ｃｏｍｐａｎｙ|Peracid-forming composition|AU2011376960B2|2011-09-14|2015-10-29|Colgate-Palmolive Company|Tooth whitening strip|

---

JP6181666B2|2011-12-19|2017-08-16|コルゲート・パーモリブ・カンパニーＣｏｌｇａｔｅ−Ｐａｌｍｏｌｉｖｅ Ｃｏｍｐａｎｙ|Peracid-forming composition|

---

CA2859793C|2011-12-19|2019-10-01|Colgate-Palmolive Company|Oral care system providing perhydrolase-catalyzed peracid formation|

---

RU2663591C2|2012-11-27|2018-08-07|Колгейт-Палмолив Компани|Bleaching compositions for mouth cavity|

---

AU2013408897B2|2013-12-23|2017-02-02|Colgate-Palmolive Company|Film forming agent containing compositions comprising polyvinyl acetate and a pigment|

---

KR102182976B1|2014-03-26|2020-11-25|주식회사 엘지생활건강|Patch for attaching to teeth or tissues surrounding teeth|

---

US9518013B2|2014-12-18|2016-12-13|Ecolab Usa Inc.|Generation of peroxyformic acid through polyhydric alcohol formate|

---

BR112017023476B8|2015-06-05|2021-08-31|Unilever Ip Holdings B V|Delivery device for delivering an enamel regeneration system to tooth surfaces|

---

WO2016192924A1|2015-06-05|2016-12-08|Unilever Plc|Oral care device|

---

US20180206960A1|2015-07-22|2018-07-26|Cao Group, Inc.|Dental treatment films incorporating unmixed reactive ingredients|

---

CN109982682A|2016-11-16|2019-07-05|高露洁-棕榄公司|Oral care composition|

---

AU2017382576B2|2016-12-20|2020-08-27|Colgate-Palmolive Company|Oral care composition and methods for whitening teeth|

---

MX2019006909A|2016-12-20|2019-08-22|Colgate Palmolive Co|Oral care composition.|

---

MX2019007098A|2016-12-20|2019-09-05|Colgate Palmolive Co|Oral care composition.|

---

EP3541354B1|2016-12-20|2021-04-28|Colgate-Palmolive Company|Oral care compositions and methods for whitening teeth|

---

EP3541353A1|2016-12-20|2019-09-25|Colgate-Palmolive Company|Oral care compositions and methods for increasing the stability of the same|

---

CN110087610A|2016-12-20|2019-08-02|高露洁-棕榄公司|Oral care composition|

---

US11110047B2|2017-08-07|2021-09-07|Colgate-Palmolive Company|Oral care compositions including cyclic anhydrides|

---

EP3806637A1|2018-06-15|2021-04-21|Ecolab USA Inc.|On site generated performic acid compositions for teat treatment|

---

AU2019414303A1|2018-12-27|2021-07-08|Colgate-Palmolive Company|Oral care compositions|

法律状态:
2020-11-10| B06F| Objections, documents and/or translations needed after an examination request according [chapter 6.6 patent gazette]|

---

2020-11-17| B06U| Preliminary requirement: requests with searches performed by other patent offices: procedure suspended [chapter 6.21 patent gazette]|

---

2020-12-08| B06F| Objections, documents and/or translations needed after an examination request according [chapter 6.6 patent gazette]|

---

2021-03-09| B09A| Decision: intention to grant [chapter 9.1 patent gazette]|

---

2021-05-25| B16A| Patent or certificate of addition of invention granted|Free format text: PRAZO DE VALIDADE: 20 (VINTE) ANOS CONTADOS A PARTIR DE 18/12/2012, OBSERVADAS AS CONDICOES LEGAIS. |

优先权:

---

申请号 | 申请日 | 专利标题

---

US201161577499P| true| 2011-12-19|2011-12-19|

---

US61/577,499|2011-12-19|

---

US61/577.499|2011-12-19|

---

PCT/US2012/070371|WO2013096321A2|2011-12-19|2012-12-18|Peracid-generating compositions|

---